DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1C and ctr5

DIOPT Version :9

Sequence 1:NP_651837.1 Gene:Ctr1C / 43668 FlyBaseID:FBgn0062411 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_594269.1 Gene:ctr5 / 2542949 PomBaseID:SPAC1142.05 Length:173 Species:Schizosaccharomyces pombe


Alignment Length:205 Identity:37/205 - (18%)
Similarity:65/205 - (31%) Gaps:81/205 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 MSMAMFFHTGDSETILFKFWRTESAMALTLSCLLIFMVAVLYEAL----KFFREWLFSWDR-KRL 120
            |||...::..|| ..|.|.|...:......|.:.||..||..|.|    :.|..|:.:... |.|
pombe    29 MSMLWNWYIHDS-CFLAKSWHINTGNKFAGSIIGIFFFAVAIEGLSLVQRMFDRWIVAHSNGKTL 92

  Fly   121 AGGRDQYNRPRRYREANYNYNQPTYPPRTNQQSGTQVYAYRPRSPSMPPLQPPGRSSPQAQSSLI 185
            :|       |.|                          .:.|.|                     
pombe    93 SG-------PLR--------------------------IFFPSS--------------------- 103

  Fly   186 LTQHTHHHVQENTPPAGRTTKLKVFCSGMHILQTFLHVLQVLISFLLMLVFMTFNVWLCVAVLLG 250
                              |..:.|:   ..:::..::....|.:.:|||:.|:||.:..:...:|
pombe   104 ------------------TVHVTVW---QQLIRAAMYSSFYLSATILMLIVMSFNGYAILFGFVG 147

  Fly   251 AGVGYYIFCA 260
            |.:|:::|.:
pombe   148 AWIGFFLFAS 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1CNP_651837.1 SelP_N <23..56 CDD:282453
Ctr 63..258 CDD:282057 34/199 (17%)
ctr5NP_594269.1 Ctr 29..155 CDD:282057 36/201 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 42 1.000 Domainoid score I3667
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12483
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.