DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1C and ctr6

DIOPT Version :9

Sequence 1:NP_651837.1 Gene:Ctr1C / 43668 FlyBaseID:FBgn0062411 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_595861.1 Gene:ctr6 / 2540641 PomBaseID:SPBC23G7.16 Length:148 Species:Schizosaccharomyces pombe


Alignment Length:233 Identity:56/233 - (24%)
Similarity:85/233 - (36%) Gaps:95/233 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 MNHHGNHGEHTKHGHHEGGAHDMSMAMFFHTG-DSETILFKFWRTESAMALTLSCLLIFMVAVLY 102
            |||.||  ...:|         .||.|.|:|. |:..|:||.|...:.....||.|.|.::..|:
pombe     1 MNHGGN--STMRH---------CSMKMTFNTDYDNLCIVFKSWHIGNLSQFLLSLLAIAILGYLF 54

  Fly   103 EALKFFREWLFSWDRKRLAGGRDQYNRPRRYREANYNYNQPTYPPRTNQQSGTQVYAYRPRSPSM 167
            |.|:.|                                   |....|..|.|   ||.:      
pombe    55 ERLRSF-----------------------------------TSLKETEFQRG---YAGQ------ 75

  Fly   168 PPLQPPGRSSPQAQSSLILTQHTHHHVQENTPPAGRTTKLKVFCSGMHILQTFLHVLQVLISFLL 232
                         ||..:||.|:      .:..:||..:|   |:        |:.:|::.|:.|
pombe    76 -------------QSEGLLTHHS------KSLKSGRPFRL---CA--------LYAVQLVFSYFL 110

  Fly   233 MLVFMTFNVWLCVAVLLGAGVGYYIFCAFRTNVQEHCN 270
            |||.||:|.::.:|:.:||..||.         :.||:
pombe   111 MLVAMTYNAYVILAIAIGAAFGYR---------RSHCD 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1CNP_651837.1 SelP_N <23..56 CDD:282453 6/16 (38%)
Ctr 63..258 CDD:282057 47/195 (24%)
ctr6NP_595861.1 Ctr 14..133 CDD:282057 45/192 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2023
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12483
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4018
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.950

Return to query results.
Submit another query.