DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1C and Slc31a2

DIOPT Version :9

Sequence 1:NP_651837.1 Gene:Ctr1C / 43668 FlyBaseID:FBgn0062411 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_079562.1 Gene:Slc31a2 / 20530 MGIID:1333844 Length:143 Species:Mus musculus


Alignment Length:196 Identity:50/196 - (25%)
Similarity:81/196 - (41%) Gaps:62/196 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 MAMFFHTGDSETILFKFWRTESAMALTLSCLLIFMVAVLYEALKFFREWLFSWDRKRLAGGRDQY 127
            |.|.|...|...:||.|||..|...:.||.|::.::|||||.:|..:..|.....:.|       
Mouse     1 MPMHFIFSDEAVLLFDFWRVHSPTGMALSVLVVLLLAVLYEGIKVGKAKLLHKTLESL------- 58

  Fly   128 NRPRRYREANYNYNQPTYPPRTNQQSGTQVYAYRPRSPSMPPLQPPGRSSPQAQSSLILTQHTHH 192
                               |.||.|..               :..|.:.|..::|:         
Mouse    59 -------------------PATNSQQF---------------ILGPDQDSTGSRST--------- 80

  Fly   193 HVQENTPPAGRTTKLKVF-CSGMHILQTFLHVLQVLISFLLMLVFMTFNVWLCVAVLLGAGVGYY 256
                    :...|:|:.| |   :..|:.:||:||:|.:.:||..|::|.|:.:.|:||:.||||
Mouse    81 --------SDNRTRLRWFLC---YFGQSLVHVIQVVIGYFVMLAVMSYNTWIFLGVVLGSAVGYY 134

  Fly   257 I 257
            :
Mouse   135 L 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1CNP_651837.1 SelP_N <23..56 CDD:282453
Ctr 63..258 CDD:282057 50/196 (26%)
Slc31a2NP_079562.1 Ctr 1..135 CDD:282057 49/194 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846126
Domainoid 1 1.000 91 1.000 Domainoid score I7689
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5076
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12483
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4018
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.890

Return to query results.
Submit another query.