DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1C and Y58A7A.1

DIOPT Version :9

Sequence 1:NP_651837.1 Gene:Ctr1C / 43668 FlyBaseID:FBgn0062411 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001256056.1 Gene:Y58A7A.1 / 190381 WormBaseID:WBGene00021975 Length:163 Species:Caenorhabditis elegans


Alignment Length:249 Identity:63/249 - (25%)
Similarity:94/249 - (37%) Gaps:98/249 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 HEGHHSPEMNHHGNHGE----HTKHGHHEGGAHDMSMAMFFHTGDSETILFKFWRTESAMALTLS 91
            |..||..   |.|..|.    .||...|    ..|:.||.||.|..|||||.||:||:|:.:.::
 Worm     3 HSQHHHV---HKGTIGNTAVAQTKSSDH----MMMNHAMSFHFGTEETILFDFWKTETAVGIAVA 60

  Fly    92 CLLIFMVAVLYEALKFFREWLFSWDRKRLAGGRDQYNRPRRYREANYNYNQPTYPPRTNQQSGTQ 156
            |.:..::|.|.|.|:|||:                      ||:|.                 ||
 Worm    61 CFITVLLAFLMETLRFFRD----------------------YRKAQ-----------------TQ 86

  Fly   157 VYAYRPRSPSMPPLQPPGR--SSPQAQSSLILTQHTHHHVQENTPPAGRTTKLKVFCSGMHILQT 219
            ::        .||:.|..|  .|||                                  :.::..
 Worm    87 LH--------QPPISPEDRLKRSPQ----------------------------------LDLIDP 109

  Fly   220 FLHVLQVLISFLLMLVFMTFNVWLCVAVLLGAGVGYYIFCAFRTNVQE----HC 269
            .|.:.|:.|::.|||:|||||.:||...::|..|.:.::.....|:..    ||
 Worm   110 LLQLFQLTIAYFLMLIFMTFNAYLCFFTVVGEVVCHLLYRTLYPNLNSSSAGHC 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1CNP_651837.1 SelP_N <23..56 CDD:282453 9/28 (32%)
Ctr 63..258 CDD:282057 50/196 (26%)
Y58A7A.1NP_001256056.1 Ctr 34..147 CDD:282057 49/193 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12483
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4018
SonicParanoid 1 1.000 - - X3487
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.050

Return to query results.
Submit another query.