DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1C and K12C11.3

DIOPT Version :9

Sequence 1:NP_651837.1 Gene:Ctr1C / 43668 FlyBaseID:FBgn0062411 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001293414.1 Gene:K12C11.3 / 187321 WormBaseID:WBGene00019674 Length:147 Species:Caenorhabditis elegans


Alignment Length:196 Identity:46/196 - (23%)
Similarity:77/196 - (39%) Gaps:69/196 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 MAMFFHTGDSETILFKFWRTESAMALTLSCLLIFMVAVLYEALKFFREWLFSWDRKRLAGGRDQY 127
            |..::|...::.|||:.|:.:....:..||.::.....|.|.|| :.:|..|. :.|.||..|  
 Worm    17 MWQWYHVELNDVILFENWKVQDMTTMIWSCFVVGFAGFLLEFLK-YSKWAASM-QMRPAGDVD-- 77

  Fly   128 NRPRRYREANYNYNQPTYPPRTNQQSGTQVYAYRPRSPSMPPLQPPGRSSPQAQSSLILTQHTHH 192
                                |..:..|..|       ||                          
 Worm    78 --------------------RRTKYGGCVV-------PS-------------------------- 89

  Fly   193 HVQENTPPAGRTTKLKVFCSGMHILQTFLHVLQVLISFLLMLVFMTFNVWLCVAVLLGAGVGYYI 257
               ||        :.|:|.: .|::|...|..|.|::|:||.::|||||::|:::.||..:||:.
 Worm    90 ---EN--------RKKLFWA-RHVVQAMYHFWQTLLAFILMNIYMTFNVYICLSLCLGLTIGYFF 142

  Fly   258 F 258
            |
 Worm   143 F 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1CNP_651837.1 SelP_N <23..56 CDD:282453
Ctr 63..258 CDD:282057 45/194 (23%)
K12C11.3NP_001293414.1 Ctr 17..143 CDD:282057 45/194 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12483
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.