DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1C and F31E8.4

DIOPT Version :9

Sequence 1:NP_651837.1 Gene:Ctr1C / 43668 FlyBaseID:FBgn0062411 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_495391.1 Gene:F31E8.4 / 174118 WormBaseID:WBGene00017954 Length:162 Species:Caenorhabditis elegans


Alignment Length:210 Identity:58/210 - (27%)
Similarity:100/210 - (47%) Gaps:55/210 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 MSMAMFFHTGDSETILFKFWRTESAMALTLSCLLIFMVAVLYEALKFFREWLFSWDRKRLAGGRD 125
            |.|.|..|.|:.|.|||.:|:|.|...:.:|.|:.|::.:||||:|.||.:|..|:.::      
 Worm     1 MDMDMTLHFGEREKILFSWWKTGSLSGMAVSMLITFLLCILYEAIKSFRYFLAVWNNQK------ 59

  Fly   126 QYNRPRRYREANYNYNQPTYPPRTNQQS--GTQVYAYRPRSPSMPPLQPPGRSSPQAQSSLILTQ 188
               |.:|:.||:.          ||.|:  |..:                      ::.|:    
 Worm    60 ---RQQRHAEASI----------TNPQNSGGDNI----------------------SEDSI---- 85

  Fly   189 HTHHHVQENTPPAGRTTKLKVFCSGMHILQTFLHVLQVLISFLLMLVFMTFNVWLCVAVLLGAGV 253
                |:......:|.|.:|  |.| ..:.|..|:.||.|:::.|||:.||:|:.|.:::::|..|
 Worm    86 ----HIAPLVQLSGFTKRL--FTS-YRLAQGALYGLQALLAYTLMLIAMTYNMNLILSIVVGEAV 143

  Fly   254 GYYIFCAFRTNVQEH 268
            ||::|.. ...|::|
 Worm   144 GYFLFTG-NPLVEQH 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1CNP_651837.1 SelP_N <23..56 CDD:282453
Ctr 63..258 CDD:282057 54/196 (28%)
F31E8.4NP_495391.1 Ctr 3..148 CDD:282057 54/196 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 1 1.000 - - otm14077
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12483
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.