DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1C and SLC31A2

DIOPT Version :9

Sequence 1:NP_651837.1 Gene:Ctr1C / 43668 FlyBaseID:FBgn0062411 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001851.1 Gene:SLC31A2 / 1318 HGNCID:11017 Length:143 Species:Homo sapiens


Alignment Length:195 Identity:51/195 - (26%)
Similarity:76/195 - (38%) Gaps:60/195 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 MAMFFHTGDSETILFKFWRTESAMALTLSCLLIFMVAVLYEALKFFREWLFSWDRKRLAGGRDQY 127
            |||.|...|:..:||.||...|...:.||.|::.::|||||.:|..:..|.:             
Human     1 MAMHFIFSDTAVLLFDFWSVHSPAGMALSVLVLLLLAVLYEGIKVGKAKLLN------------- 52

  Fly   128 NRPRRYREANYNYNQPTYPPRTNQQSGTQVYAYRPRSPSMPPLQPPGRSSPQAQSSLILTQHTHH 192
                                        ||....|.|.|...:......|..:.|.         
Human    53 ----------------------------QVLVNLPTSISQQTIAETDGDSAGSDSF--------- 80

  Fly   193 HVQENTPPAGRTTKLKVFCSGMHILQTFLHVLQVLISFLLMLVFMTFNVWLCVAVLLGAGVGYYI 257
                   |.|||......|   |..|:.:||:||:|.:.:||..|::|.|:.:.|:||:.||||:
Human    81 -------PVGRTHHRWYLC---HFGQSLIHVIQVVIGYFIMLAVMSYNTWIFLGVVLGSAVGYYL 135

  Fly   258  257
            Human   136  135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1CNP_651837.1 SelP_N <23..56 CDD:282453
Ctr 63..258 CDD:282057 51/195 (26%)
SLC31A2NP_001851.1 Ctr 3..135 CDD:309321 48/191 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155685
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12483
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4018
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.