DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctr1C and SLC31A1

DIOPT Version :9

Sequence 1:NP_651837.1 Gene:Ctr1C / 43668 FlyBaseID:FBgn0062411 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001850.1 Gene:SLC31A1 / 1317 HGNCID:11016 Length:190 Species:Homo sapiens


Alignment Length:268 Identity:71/268 - (26%)
Similarity:105/268 - (39%) Gaps:89/268 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 HVHHHA-----SHGSPEPVPPSSGHEGHHSPEMNHHGNHGEHTKHGHHEGGAHDMSMAMFFHTG- 70
            |.||..     |:.:.:|        .||.|..:        ..|.|..|.:..|.|.|.|:.| 
Human     3 HSHHMGMSYMDSNSTMQP--------SHHHPTTS--------ASHSHGGGDSSMMMMPMTFYFGF 51

  Fly    71 DSETILFKFWRTESAMALTLSCLLIFMVAVLYEALKFFREWLFSWDRKRLAGGRDQYNRPRRYRE 135
            .:..:||......:|..:..:.:.:|::|:.||.||..||.|.                  |..:
Human    52 KNVELLFSGLVINTAGEMAGAFVAVFLLAMFYEGLKIARESLL------------------RKSQ 98

  Fly   136 ANYNYNQPTYPPRTNQQSGTQVYAYRPRSPSMPPLQPPGRSSPQAQSSLILTQHTHHHVQENTPP 200
            .:..||                        |||...|.|          .:...||..|.:.   
Human    99 VSIRYN------------------------SMPVPGPNG----------TILMETHKTVGQQ--- 126

  Fly   201 AGRTTKLKVFCSGMHILQTFLHVLQVLISFLLMLVFMTFNVWLCVAVLLGAGVGYYIFC---AFR 262
                     ..|..|:|||.||::||:||:.|||:|||:|.:||:||..|||.||::|.   |..
Human   127 ---------MLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVV 182

  Fly   263 TNVQEHCN 270
            .::.|||:
Human   183 VDITEHCH 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ctr1CNP_651837.1 SelP_N <23..56 CDD:282453 6/32 (19%)
Ctr 63..258 CDD:282057 54/195 (28%)
SLC31A1NP_001850.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 10/47 (21%)
Ctr 45..175 CDD:398012 53/193 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3386
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2329
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1389393at2759
OrthoFinder 1 1.000 - - FOG0000938
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12483
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4018
SonicParanoid 1 1.000 - - X3487
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.