DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptx1 and HB5

DIOPT Version :10

Sequence 1:NP_001138130.2 Gene:Ptx1 / 43664 FlyBaseID:FBgn0020912 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_201334.1 Gene:HB5 / 836656 AraportID:AT5G65310 Length:312 Species:Arabidopsis thaliana


Alignment Length:87 Identity:21/87 - (24%)
Similarity:42/87 - (48%) Gaps:15/87 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 ENISSSGHDEPMTTSGEEPKNDKKNKRQRRQRTHFTSQQLQELEHTFSRNRYPDMSTREEIAMWT 301
            |::...||  ..:|:.|         ::||    ...:|::.||..|..:...:...:.::|...
plant    57 EDLGGVGH--ASSTAAE---------KKRR----LGVEQVKALEKNFEIDNKLEPERKVKLAQEL 106

  Fly   302 NLTEARVRVWFKNRRAKWRKRE 323
            .|...:|.:||:||||:|:.::
plant   107 GLQPRQVAIWFQNRRARWKTKQ 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptx1NP_001138130.2 Homeodomain 265..321 CDD:459649 16/55 (29%)
HB5NP_201334.1 Homeodomain 72..125 CDD:459649 15/56 (27%)
HALZ 127..168 CDD:460477 0/2 (0%)

Return to query results.
Submit another query.