DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptx1 and HAT1

DIOPT Version :9

Sequence 1:NP_001138130.2 Gene:Ptx1 / 43664 FlyBaseID:FBgn0020912 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_193476.1 Gene:HAT1 / 827457 AraportID:AT4G17460 Length:282 Species:Arabidopsis thaliana


Alignment Length:195 Identity:50/195 - (25%)
Similarity:79/195 - (40%) Gaps:30/195 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 GQDLVGGYSQ-HPHHTVVPPHTPKHEPLEKLRI--WAET----GDFRDSHSSMTAVANSLDST-- 202
            |..|..|::| ||....:.|.:   .|:..|::  |.:|    .|.:..........|||.:|  
plant     9 GLSLSLGFAQNHPLQLNLKPTS---SPMSNLQMFPWNQTLVSSSDQQKQQFLRKIDVNSLPTTVD 70

  Fly   203 -------HLNNFQTSSTSSISNRSRDRK--DGNRSVNETTIKTENISSSGHDEPMTTSGEEPKND 258
                   ...|...|||.|...||.:|:  .|....::..|..:..||.|      ||.||   :
plant    71 LEEETGVSSPNSTISSTVSGKRRSTEREGTSGGGCGDDLDITLDRSSSRG------TSDEE---E 126

  Fly   259 KKNKRQRRQRTHFTSQQLQELEHTFSRNRYPDMSTREEIAMWTNLTEARVRVWFKNRRAKWRKRE 323
            .......|::...:..|...||.||..:...:...:..:|....||..:|.|||:||||:.:.::
plant   127 DYGGETCRKKLRLSKDQSAVLEDTFKEHNTLNPKQKLALAKKLGLTARQVEVWFQNRRARTKLKQ 191

  Fly   324  323
            plant   192  191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptx1NP_001138130.2 Homeobox 268..320 CDD:278475 16/51 (31%)
HAT1NP_193476.1 HD-ZIP_N 8..98 CDD:282474 23/91 (25%)
HOX 134..188 CDD:197696 17/53 (32%)
HALZ 190..233 CDD:128634 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.