Sequence 1: | NP_001138130.2 | Gene: | Ptx1 / 43664 | FlyBaseID: | FBgn0020912 | Length: | 610 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_193476.1 | Gene: | HAT1 / 827457 | AraportID: | AT4G17460 | Length: | 282 | Species: | Arabidopsis thaliana |
Alignment Length: | 195 | Identity: | 50/195 - (25%) |
---|---|---|---|
Similarity: | 79/195 - (40%) | Gaps: | 30/195 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 147 GQDLVGGYSQ-HPHHTVVPPHTPKHEPLEKLRI--WAET----GDFRDSHSSMTAVANSLDST-- 202
Fly 203 -------HLNNFQTSSTSSISNRSRDRK--DGNRSVNETTIKTENISSSGHDEPMTTSGEEPKND 258
Fly 259 KKNKRQRRQRTHFTSQQLQELEHTFSRNRYPDMSTREEIAMWTNLTEARVRVWFKNRRAKWRKRE 323
Fly 324 323 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ptx1 | NP_001138130.2 | Homeobox | 268..320 | CDD:278475 | 16/51 (31%) |
HAT1 | NP_193476.1 | HD-ZIP_N | 8..98 | CDD:282474 | 23/91 (25%) |
HOX | 134..188 | CDD:197696 | 17/53 (32%) | ||
HALZ | 190..233 | CDD:128634 | 0/2 (0%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |