DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptx1 and Barx2

DIOPT Version :10

Sequence 1:NP_001138130.2 Gene:Ptx1 / 43664 FlyBaseID:FBgn0020912 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_001414382.1 Gene:Barx2 / 679701 RGDID:1584840 Length:290 Species:Rattus norvegicus


Alignment Length:79 Identity:27/79 - (34%)
Similarity:43/79 - (54%) Gaps:0/79 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 GHDEPMTTSGEEPKNDKKNKRQRRQRTHFTSQQLQELEHTFSRNRYPDMSTREEIAMWTNLTEAR 307
            |.:...::..|..:...:.|:.||.||.||..||..||..|.:.:|.....|.::|....||:.:
  Rat   123 GGEALASSESETEQPTPRQKKPRRSRTIFTELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQ 187

  Fly   308 VRVWFKNRRAKWRK 321
            |:.|::|||.||:|
  Rat   188 VKTWYQNRRMKWKK 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptx1NP_001138130.2 Homeodomain 265..321 CDD:459649 23/55 (42%)
Barx2NP_001414382.1 None

Return to query results.
Submit another query.