DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptx1 and gsb-n

DIOPT Version :9

Sequence 1:NP_001138130.2 Gene:Ptx1 / 43664 FlyBaseID:FBgn0020912 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster


Alignment Length:403 Identity:109/403 - (27%)
Similarity:147/403 - (36%) Gaps:160/403 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 STSSISN--RSRDR--KDGNRSVNETTIKTENISSSGHDEPMTTSGEEPKNDKKNKRQRRQRTHF 271
            ||||||.  |..||  :||.:..      |.|....|.|..::.:..||....|.| |||.||.|
  Fly   132 STSSISRLLRGSDRGSEDGRKDY------TINGILGGRDSDISDTESEPGIPLKRK-QRRSRTTF 189

  Fly   272 TSQQLQELEHTFSRNRYPDMSTREEIAMWTNLTEARVRVWFKNRRAKWRKRERNAMNAAVAAADF 336
            |::||:.||..|||.:|||:.||||:|..|.|||||::|||.||||:.||.              
  Fly   190 TAEQLEALERAFSRTQYPDVYTREELAQTTALTEARIQVWFSNRRARLRKH-------------- 240

  Fly   337 KSGFGTQFMQPFADDSLYSSYPYNNWTKVPSPLGTKPFPWPVNPLGSMVAGNHHQNSVNCFNTGA 401
             ||.....:.|                                                 .|:|:
  Fly   241 -SGGSNSGLSP-------------------------------------------------MNSGS 255

  Fly   402 S----GVAVSMNNASMLPGSMGSSLSNTSNVGAVG--APCPYTTPANPYMYRSAAEPCMSSSMSS 460
            |    ||.:|...|.:..|.:|        ||::.  :|.|.||             ...:.|:.
  Fly   256 SNVGVGVGLSGATAPLGYGPLG--------VGSMAGYSPAPGTT-------------ATGAGMND 299

  Fly   461 SIATLRLKAKQHASAGFGSPYSAPSPVSRSNSAGLSACQYTGVGVTDVVXENALGALLNQHQHHL 525
            .:        .||:       .|||....:.:|..:|..:|.:|..|:|            |...
  Fly   300 GV--------HHAA-------HAPSSHHSAATAAAAAHHHTQMGGYDLV------------QSAA 337

  Fly   526 QHFSGGSVGGSGVPNGMQQ--HSG--NMLH--HSNLGLDHSDLGLVGG------GPSNHQDEGNH 578
            ||         |.|.|..|  |.|  |..|  :|.|.:|  |...:..      .||.|..:   
  Fly   338 QH---------GFPGGFAQPGHFGSQNYYHQDYSKLTID--DFSKLTADSVSKISPSLHLSD--- 388

  Fly   579 SLEGSNKSPMEAP 591
                 |.|.:|||
  Fly   389 -----NYSKLEAP 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptx1NP_001138130.2 Homeobox 268..320 CDD:278475 32/51 (63%)
gsb-nNP_523862.1 PAX 20..141 CDD:278709 6/8 (75%)
Homeobox 185..238 CDD:278475 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450930
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.