DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptx1 and al

DIOPT Version :9

Sequence 1:NP_001138130.2 Gene:Ptx1 / 43664 FlyBaseID:FBgn0020912 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster


Alignment Length:374 Identity:106/374 - (28%)
Similarity:147/374 - (39%) Gaps:133/374 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 DRKDGNRSVNETTIKTENIS------------SSGHDEPMTTSGEEPKNDK--KNKRQRRQRTHF 271
            ||..|:.:.:.....|.::|            |.|.:.|::....:.:.|:  ..::|||.||.|
  Fly    28 DRAPGSSAASAGAALTVSMSVSGGAPSGASGASGGTNSPVSDGNSDCEADEYAPKRKQRRYRTTF 92

  Fly   272 TSQQLQELEHTFSRNRYPDMSTREEIAMWTNLTEARVRVWFKNRRAKWRKRER------------ 324
            ||.||:|||..|||..|||:.||||:||...|||||::|||:||||||||:|:            
  Fly    93 TSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEKVGPQSHPYNPYL 157

  Fly   325 ----------------------------------NAMNAAV-------AAADFKSGFGTQF---- 344
                                              :|.|.|.       ||....||:..||    
  Fly   158 PGGAATMQTVVGAALPPNPFTHLGFQLRKPFDAQHAANLAAFRYPHLSAAPMIPSGYFNQFQRAP 222

  Fly   345 --MQPFADDSLYS-SYPYN----NWTKVP--SPLGTKPFPWPVNPLGSMVAGNHHQNSVNCF--- 397
              |.|.....:|| |..:.    |.|.||  :|||..|         :::.|:...:|.|..   
  Fly   223 PHMLPHGMAGMYSPSSSFQSLLANMTAVPRGTPLGKPP---------ALLVGSPDLHSPNHMLAS 278

  Fly   398 --NTGASGVA---------------------VSMNNASMLPGSM--------GSSLS--NTSNVG 429
              .:.|||.|                     |.:..|.:.|..:        .||||  .||.|.
  Fly   279 PPTSPASGHASQHQQHPTAHPPPPQAPPQMPVGVQPAQLSPQHLVGIALTQQASSLSPTQTSPVA 343

  Fly   430 AVGAPCPY------TTPANPYMYRSAAEPCMSSSMSSSIATLRLKAKQH 472
            ...:..|.      :..|.|...|:|..|  ....:||||.|||||::|
  Fly   344 LTLSHSPQRQLPPPSHQAPPPPPRAATPP--EDRRTSSIAALRLKAREH 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptx1NP_001138130.2 Homeobox 268..320 CDD:278475 35/51 (69%)
alNP_722629.1 Homeobox 89..141 CDD:278475 35/51 (69%)
OAR 374..391 CDD:281777 10/17 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450933
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.