DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptx1 and HOXC5

DIOPT Version :10

Sequence 1:NP_001138130.2 Gene:Ptx1 / 43664 FlyBaseID:FBgn0020912 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_061826.1 Gene:HOXC5 / 3222 HGNCID:5127 Length:222 Species:Homo sapiens


Alignment Length:81 Identity:18/81 - (22%)
Similarity:33/81 - (40%) Gaps:23/81 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 KKHDWDKITKEIE---------------KDDETKDDVSDLFKKIYADASEDTR---KAMMKSYYE 150
            |:..|::..|.|:               |.:|..|...:.|:|:..:.|..|.   |::||   .
Human    48 KRVVWEEKLKMIKLHNRENSLGKNGFTMKMNEFGDQTDEEFRKMMIEISVWTHREGKSIMK---R 109

  Fly   151 SGGTVLS--TNWAEVG 164
            ..|::|.  .:|.:.|
Human   110 EAGSILPKFVDWRKKG 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptx1NP_001138130.2 Homeodomain 265..321 CDD:459649
HOXC5NP_061826.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..141 14/61 (23%)
Antp-type hexapeptide 140..145
Homeodomain 156..212 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.