DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptx1 and dharma

DIOPT Version :10

Sequence 1:NP_001138130.2 Gene:Ptx1 / 43664 FlyBaseID:FBgn0020912 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_571054.1 Gene:dharma / 30170 ZFINID:ZDB-GENE-990415-22 Length:192 Species:Danio rerio


Alignment Length:86 Identity:38/86 - (44%)
Similarity:49/86 - (56%) Gaps:5/86 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 SGHDEPMTTSG-EEPKNDKKNKRQR---RQRTHFTSQQLQELEHTFSRNRYPDMSTREEIAMWTN 302
            :|...|...:| |..:|......||   |.||.||..|.::||..|:...||.:.||.|:|..|.
Zfish    89 AGQPWPYAVAGCETAENHYHTIAQRPRGRIRTVFTDNQTEQLERLFAVTDYPTVETRAELAQNTG 153

  Fly   303 LTEARVRVWFKNRRAKWRKRE 323
            |:|..||||||||||: |||:
Zfish   154 LSEETVRVWFKNRRAR-RKRQ 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptx1NP_001138130.2 Homeodomain 265..321 CDD:459649 29/58 (50%)
dharmaNP_571054.1 Homeodomain 117..172 CDD:459649 29/55 (53%)

Return to query results.
Submit another query.