DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptx1 and Drgx

DIOPT Version :9

Sequence 1:NP_001138130.2 Gene:Ptx1 / 43664 FlyBaseID:FBgn0020912 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_665710.2 Gene:Drgx / 252880 RGDID:628616 Length:263 Species:Rattus norvegicus


Alignment Length:257 Identity:86/257 - (33%)
Similarity:121/257 - (47%) Gaps:50/257 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 KRQRRQRTHFTSQQLQELEHTFSRNRYPDMSTREEIAMWTNLTEARVRVWFKNRRAKWRKRERNA 326
            ::|||.||.||.|||:.||..|::..|||:.||||:||..|||||||:|||:||||||||.||.|
  Rat    31 RKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAMKINLTEARVQVWFQNRRAKWRKTERGA 95

  Fly   327 MNAAVAAADFKSGFGTQFMQPFADDSLYSSYPYNNWTKVPSPLGTKPFPWPVNPLGSMVAGNHH- 390
            .:....|           .:|.|:   .:..|..|   :.||           |.|....|... 
  Rat    96 SDQEPGA-----------KEPMAE---VTPPPVRN---INSP-----------PPGDQARGKKEA 132

  Fly   391 ---QNSVNCFNTGASGVAVSMNNASMLPGSM------GSSLSNTSNVGAVGAP-CPYTTPANPYM 445
               |.|:. ...|.:|...    .|.|||::      ..:||:.:::  .|.| |....| :|..
  Rat   133 LEAQQSLG-RTVGPAGPFF----PSCLPGTLLNTATYAQALSHVASL--KGGPLCSCCVP-DPMG 189

  Fly   446 YRSAAEPCMSSSMSSSIATLRLKAKQHASAGFGSPYSAPSPVSRSNSAGLSACQYTGVGVTD 507
            ..........|:.::|:|.||:||::|:.|...|....|   |.|:|.|.::.|....|..|
  Rat   190 LSFLPTYGCQSNRTASVAALRMKAREHSEAVLQSANLLP---STSSSPGPASKQVPPEGSQD 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptx1NP_001138130.2 Homeobox 268..320 CDD:278475 34/51 (67%)
DrgxNP_665710.2 Homeobox 37..90 CDD:395001 35/52 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..135 16/74 (22%)
OAR 201..218 CDD:397759 7/16 (44%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 204..217 6/12 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..263 10/33 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.