DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptx1 and ceh-54

DIOPT Version :9

Sequence 1:NP_001138130.2 Gene:Ptx1 / 43664 FlyBaseID:FBgn0020912 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_001338798.1 Gene:ceh-54 / 188474 WormBaseID:WBGene00020485 Length:221 Species:Caenorhabditis elegans


Alignment Length:218 Identity:54/218 - (24%)
Similarity:93/218 - (42%) Gaps:69/218 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 NDKKNKRQRRQRTHFTSQQLQELEHTFSRNRYPDMSTREEIAMWTNLTEARVRVWFKNRRAKWRK 321
            |:....|::|.|..|.:.|:.|:|..|:.|:|||..:||::|....|.|.||::||:|||||:|:
 Worm    38 NNFNPDRKKRNRITFDANQIDEMEKVFAENQYPDTMSREKLANKIQLHEERVQIWFQNRRAKYRR 102

  Fly   322 RERNAMNAAVAAADFKSGFGTQFMQPFADDSLYSSYPYNNWTKVPSPLGTKPFPWPVNPLGSMVA 386
            .::.                             :.:||.      .|..||      ||.|    
 Worm   103 EQKQ-----------------------------TGHPYE------PPSITK------NPTG---- 122

  Fly   387 GNHHQNSVNCFNTGASGVAVSMNNASMLPGSMGSSLSNTSNVGAVGAPCPYTTPANPYMYRSAAE 451
              ..:.:.:|         .::.:||. ||.  |:|||.:.|....||...|...|.:     .:
 Worm   123 --EKEKTQDC---------TTLTSASS-PGP--SNLSNDTLVSIEMAPKIGTKSVNLF-----PD 168

  Fly   452 PCMSSSMSSSIATLRLKAKQHAS 474
            ..:|::::     :.:.|.::||
 Worm   169 QALSNTLN-----MIINANKNAS 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptx1NP_001138130.2 Homeobox 268..320 CDD:278475 24/51 (47%)
ceh-54NP_001338798.1 Homeobox 49..102 CDD:365835 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.