DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptx1 and DLX5

DIOPT Version :10

Sequence 1:NP_001138130.2 Gene:Ptx1 / 43664 FlyBaseID:FBgn0020912 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_005212.1 Gene:DLX5 / 1749 HGNCID:2918 Length:289 Species:Homo sapiens


Alignment Length:204 Identity:50/204 - (24%)
Similarity:85/204 - (41%) Gaps:48/204 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 SSSGHDEPMTTSGEEPKNDKKNKRQRRQRTHFTSQQLQELEHTFSRNRYPDMSTREEIAMWTNLT 304
            |::...|...|..|....:.|.|:.|:.||.::|.||..|:..|.:.:|..:..|.|:|....||
Human   113 SATNQPEKEVTEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLT 177

  Fly   305 EARVRVWFKNRRAKWRKRERNAMNAAVAAADFKSGFGTQFMQPFADDSLYSSYPYNNWTKVPSPL 369
            :.:|::||:|:|:|.:|             ..|:|.......|.:.|.:..:.|.:         
Human   178 QTQVKIWFQNKRSKIKK-------------IMKNGEMPPEHSPSSSDPMACNSPQS--------- 220

  Fly   370 GTKPFPWPVNPLGSMVAGNHH-----------------QNSVNCFNTGASGVAVSMNNASMLPGS 417
               |..|  .|.||..:.:||                 :||.:.:.:.||    |:|:....|||
Human   221 ---PAVW--EPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAAS----SINSHLPPPGS 276

  Fly   418 MGSSLSNTS 426
            :...|:..|
Human   277 LQHPLALAS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptx1NP_001138130.2 Homeodomain 265..321 CDD:459649 20/55 (36%)
DLX5NP_005212.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
DLL_N 32..118 CDD:463567 1/4 (25%)
Homeodomain 138..194 CDD:459649 20/55 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..251 11/66 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..289 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.