DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptx1 and Barx2

DIOPT Version :10

Sequence 1:NP_001138130.2 Gene:Ptx1 / 43664 FlyBaseID:FBgn0020912 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_038828.2 Gene:Barx2 / 12023 MGIID:109617 Length:283 Species:Mus musculus


Alignment Length:79 Identity:27/79 - (34%)
Similarity:43/79 - (54%) Gaps:0/79 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 GHDEPMTTSGEEPKNDKKNKRQRRQRTHFTSQQLQELEHTFSRNRYPDMSTREEIAMWTNLTEAR 307
            |.:...::..|..:...:.|:.||.||.||..||..||..|.:.:|.....|.::|....||:.:
Mouse   116 GGEALASSESETEQPTPRQKKPRRSRTIFTELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQ 180

  Fly   308 VRVWFKNRRAKWRK 321
            |:.|::|||.||:|
Mouse   181 VKTWYQNRRMKWKK 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptx1NP_001138130.2 Homeodomain 265..321 CDD:459649 23/55 (42%)
Barx2NP_038828.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 107..141 5/24 (21%)
Homeodomain 138..194 CDD:459649 23/55 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..283
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.