DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptx1 and pitx3

DIOPT Version :9

Sequence 1:NP_001138130.2 Gene:Ptx1 / 43664 FlyBaseID:FBgn0020912 Length:610 Species:Drosophila melanogaster
Sequence 2:XP_002935807.2 Gene:pitx3 / 100496690 XenbaseID:XB-GENE-486162 Length:292 Species:Xenopus tropicalis


Alignment Length:315 Identity:138/315 - (43%)
Similarity:176/315 - (55%) Gaps:50/315 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 NFQTSSTSSISNRSRDRKDGNRSVNETTIKTENISSSGHDEPMTTSGEEPKNDKKNKRQRRQRTH 270
            :|...:.|...:.:....|.....::.:.|.:..|.:...:...|....|::....|:|||||||
 Frog     2 DFNLLTDSEARSPALSLSDSGTPQHDHSCKGQEHSDTEKSQQNQTDDSNPEDGTLKKKQRRQRTH 66

  Fly   271 FTSQQLQELEHTFSRNRYPDMSTREEIAMWTNLTEARVRVWFKNRRAKWRKRERNAMNAAVAAAD 335
            ||||||||||.||.||||||||||||||:||||||||||||||||||||||||||..     |..
 Frog    67 FTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQ-----AEL 126

  Fly   336 FKSGFGTQF---MQPFADDSLYSSYPYNNW-TK--VPSPLGTKPFPW----PVNPLGSMVAGNHH 390
            .|:.||.||   |||:  |.:||.|.|||| ||  ..|||..|.||:    .|:||.|       
 Frog   127 CKNSFGAQFNGLMQPY--DDMYSGYSYNNWATKGLATSPLSAKSFPFFNSMNVSPLSS------- 182

  Fly   391 QNSVNCFNTGASGVAVSMNNASMLPGSMGSSLSNTSNVGAVGAP----------CPYTTPANPYM 445
            |...:..|:.||....|....|.:.|..||||:|..|:..:.:|          |||.:.|:|||
 Frog   183 QPMFSPPNSIASMTMPSSMVPSAVTGVPGSSLNNLGNINNLNSPSLNSAVSASACPYASTASPYM 247

  Fly   446 YRSAAEPCMSSSMSSSIATLRLKAKQHASAGFGSPYSAPSPVSRSNSAGLSACQY 500
            ||   :.|     :||:|:|||||||||:..:        |..::.::.||.|||
 Frog   248 YR---DTC-----NSSLASLRLKAKQHANFTY--------PAVQTPASNLSPCQY 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptx1NP_001138130.2 Homeobox 268..320 CDD:278475 48/51 (94%)
pitx3XP_002935807.2 Homeobox 64..117 CDD:395001 49/52 (94%)
OAR 250..267 CDD:397759 11/21 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5880
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 212 1.000 Inparanoid score I3553
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1432356at2759
OrthoFinder 1 1.000 - - FOG0001767
OrthoInspector 1 1.000 - - otm47770
Panther 1 1.100 - - O PTHR45882
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.