DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptx1 and LOC100364002

DIOPT Version :9

Sequence 1:NP_001138130.2 Gene:Ptx1 / 43664 FlyBaseID:FBgn0020912 Length:610 Species:Drosophila melanogaster
Sequence 2:XP_006257545.2 Gene:LOC100364002 / 100364002 RGDID:2321855 Length:227 Species:Rattus norvegicus


Alignment Length:227 Identity:53/227 - (23%)
Similarity:86/227 - (37%) Gaps:58/227 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 QDLVGG-------YSQHPHHTVVPPHTPKHEPLEKLRI------WAETGDFRDSHSSMTAVANSL 199
            |.||||       ..|.....:...:.|:.||.| |.:      ..|.||.::.........:..
  Rat    44 QRLVGGLVQGGLDQGQPAQGQLAGGNLPQEEPAE-LSLAQDATGVGEEGDEKEEEMEARYAGDGA 107

  Fly   200 DSTHLNNFQTSSTSSISNRSRDRKDGNRSVNETTIKTENISSSGHDEPMTTSGEEPKNDKKNKRQ 264
            .....||.|              ::|::..|:.....:..:.     |..:.|::..|:..:.|.
  Rat   108 YGPEDNNVQ--------------QEGDQHPNDQEQPQQEAAI-----PEGSRGQQAGNNLAHPRY 153

  Fly   265 RRQRTHFTSQQLQELEHTFSRNRYPDMSTREEIAMWTNLTEARVRVWFKNRRAKWRKRERNAMNA 329
              .||.||..||::||..|...|||.:.||::||.|..:.|..|:.||:.||:.:::..|..:..
  Rat   154 --SRTRFTPSQLRDLERLFQETRYPSLRTRKDIARWMGVEECDVQNWFRMRRSLFQRSRRVLLLC 216

  Fly   330 AVAAADFKSGFGTQFMQPFADDSLYSSYPYNN 361
            .              :|||         |.||
  Rat   217 T--------------LQPF---------PQNN 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptx1NP_001138130.2 Homeobox 268..320 CDD:278475 23/51 (45%)
LOC100364002XP_006257545.2 Homeobox 154..211 CDD:395001 23/56 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.