DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and CYP4F2

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001073.3 Gene:CYP4F2 / 8529 HGNCID:2645 Length:520 Species:Homo sapiens


Alignment Length:450 Identity:164/450 - (36%)
Similarity:252/450 - (56%) Gaps:35/450 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 RVWQG-TAPRVLLFEPETVEPILNS-------QKFVNKSHDYDYLHPWLGEGLLTSTDRKWHSRR 155
            :||.| .:|.:.|..|:.:..::|:       .||.     |.:|.||||:|||.|...||...|
Human    89 KVWMGPISPLLSLCHPDIIRSVINASAAIAPKDKFF-----YSFLEPWLGDGLLLSAGDKWSRHR 148

  Fly   156 KILTPAFHFKILDDFIDVFNEQSAVLARK--LAVEVGSEAFNLFPYVTLCTLDIVCETAMGRRIY 218
            ::|||||||.||..::.:|||...::..|  |....||...::|.:::|.|||.:.:.......:
Human   149 RMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSACLDMFEHISLMTLDSLQKCVFSFDSH 213

  Fly   219 AQSNSESEYVKAVYGIGSIVQSRQAKIWLQSDFIFSLTAEYKLHQSYINTLHGFSNMVIRERKAE 283
            .| ...|||:.|:..:.::|..|..:|.|..||::.||.:.:..:.....:|.|::.||:||:..
Human   214 CQ-EKPSEYIAAILELSALVSKRHHEILLHIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRT 277

  Fly   284 LAILQENNNNNNNNAPDAYDDVGKKKRLAFLD-LLIDASKEGTVLSNEDIREEVDTFMFEGHDTT 347
            |.         :....|......|.|.|.|:| ||:...::|..||:||||.|.|||||||||||
Human   278 LP---------SQGVDDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTT 333

  Fly   348 SAAISWTLFLLGCHPEYQERVVEELDSIFGDDKETPATMKNLMDMRYLECCIKDSLRLFPSVPMM 412
            ::.:||.|:.|..|||||||..:|:..:..|.:.......:|..:.:|..|:|:||||.|.||::
Human   334 ASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEWDDLAHLPFLTMCMKESLRLHPPVPVI 398

  Fly   413 ARMVGEDVNI-GGKIVPAGTQAIIMTYALHRNPRVFPKPEQFNPDNFLPENCAGRHPFAYIPFSA 476
            :|.|.:|:.: .|:::|.|...:|..:..|.||.|:|.||.::|..|.|||...|.|.|:|||||
Human   399 SRHVTQDIVLPDGRVIPKGIICLISVFGTHHNPAVWPDPEVYDPFRFDPENIKERSPLAFIPFSA 463

  Fly   477 GPRNCIGQKFAILEEKAVISTVLRKYKI---EAVDRREDLTLLGELILRPKDGLRVKITP 533
            ||||||||.||:.|.|.|::..|.::::   ....||:.     ||:||.:.||.:::.|
Human   464 GPRNCIGQTFAMAEMKVVLALTLLRFRVLPDHTEPRRKP-----ELVLRAEGGLWLRVEP 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 163/446 (37%)
CYP4F2NP_001073.3 DUF4175 4..>57 CDD:372724
p450 52..515 CDD:365848 163/445 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154683
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.