DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and CYP96A3

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_176713.1 Gene:CYP96A3 / 842842 AraportID:AT1G65340 Length:503 Species:Arabidopsis thaliana


Alignment Length:471 Identity:104/471 - (22%)
Similarity:204/471 - (43%) Gaps:96/471 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 VLLFEPETVEPILNSQKFVN--KSHDYDYLHPWLGEGLLTSTDRKWH------------------ 152
            :|..:|..:..||:| .|.|  |..::..:...:|:.:.......|.                  
plant    81 LLTVDPVNIHYILSS-NFANYPKGMEFKKIFEVVGDSIFNVDSGLWEDMRNSSHAIFSNQDFQMF 144

  Fly   153 ----SRRKI---LTPAFHFKILDDFIDVFNEQSAVLARKLAVEVGSEAFNLFPYVTLCTLDIVCE 210
                |.||:   |.|     ||::..|          :.:.|:: .:.|..|.:.|    .::..
plant   145 WVSTSVRKLRQGLVP-----ILENAAD----------KNILVDL-QDLFQRFLFDT----SLILM 189

  Fly   211 TAMGRRIYAQSNSESEYVKAVYGIGSIVQSRQAK---IWLQSDFIFSLTAEYKLHQSYINTLHGF 272
            |....:..:....:.|:..||.|:...|..|..|   :| :..::..:..|.:|.:.    |..|
plant   190 TGYDPKCLSVEMPKVEFGDAVDGVSDGVFYRHVKPVFLW-RLQYLIGVGVEKRLKRG----LAVF 249

  Fly   273 SNM---VIRERKAELAILQENNNNNNNNAPDAYDDVGKKKRLAFLDLL-----IDASKEGTVLSN 329
            ..:   :|..::.|:       |::..:.|         .|...:|:|     :|.:|...:..:
plant   250 DQLLEKIITAKREEI-------NSHGTHHP---------SRGEAIDVLTYYMTMDTTKYKYLEPS 298

  Fly   330 ED--IREEVDTFMFEGHDTTSAAISWTLFLLGCHPEYQERVVEELDSIFGDDKETPATMKNLMDM 392
            :|  |::.:..|:....||||:|::|..:|:..:||...::.:|::...  .:..||.::.|:  
plant   299 DDRFIKDTILGFLIAARDTTSSALTWFFWLMSKNPEAINKIRQEVNKKM--PRFDPADLEKLV-- 359

  Fly   393 RYLECCIKDSLRLFPSVPMMARMVGE-DVNIGGKIVPAGTQAIIMTYALHRNPRVF-PKPEQFNP 455
             ||...:.::|||:|.||...:...: ||...|..|....:.:|..|||.|...|: ...|.|.|
plant   360 -YLHGAVCETLRLYPPVPFNHKSPAKPDVLPSGHRVDEKWKIVISMYALGRMKSVWGDDAEDFRP 423

  Fly   456 DNFLPENCAGRH--PFAYIPFSAGPRNCIGQKFAILEEKAVISTVLRKYKIEAVD--RREDLTLL 516
            :.::.::...:|  .:.::.|:||||.|:|:|...|:.|.|.:.::|.|.|:.|:  :.|.:.  
plant   424 ERWISDSGRLKHEPSYKFLAFNAGPRACLGKKLTFLQMKTVAAEIIRNYDIKVVEGHKTEPVP-- 486

  Fly   517 GELILRPKDGLRVKIT 532
             .::.|.:.||:|.||
plant   487 -SVLFRMQHGLKVNIT 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 102/468 (22%)
CYP96A3NP_176713.1 p450 22..502 CDD:386267 104/471 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1194
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.