DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and CYP97A3

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_564384.1 Gene:CYP97A3 / 840067 AraportID:AT1G31800 Length:595 Species:Arabidopsis thaliana


Alignment Length:471 Identity:117/471 - (24%)
Similarity:213/471 - (45%) Gaps:52/471 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 IGMQKLWGTRIGINRVWQGTAPRVLLFEPETVEPIL-NSQKFVNKSHDYDYLHPWLGEGLLTSTD 148
            |.:.:|:.|..||.|:..|....:::.:|...:.|| ::.|..:|....:.|...:|:||:.:..
plant   130 IPLYELFLTYGGIFRLTFGPKSFLIVSDPSIAKHILKDNAKAYSKGILAEILDFVMGKGLIPADG 194

  Fly   149 RKWHSRRKILTPAFHFKILDDFIDVFNEQSAVLARKL-AVEVGSEAFNLFPYVTLCTLDIVCETA 212
            ..|..||:.:.||.|.|.:...|.:|.|.|..|.:|| |..:..|...:....:..||||:    
plant   195 EIWRRRRRAIVPALHQKYVAAMISLFGEASDRLCQKLDAAALKGEEVEMESLFSRLTLDII---- 255

  Fly   213 MGRRIYAQS----NSESEYVKAVYGIGSIVQSRQAK--------IWLQ-SDFIFSLTAEYKLHQS 264
             |:.::...    .:::..::|||.:....:.|...        ||.. |.....:....||...
plant   256 -GKAVFNYDFDSLTNDTGVIEAVYTVLREAEDRSVSPIPVWDIPIWKDISPRQRKVATSLKLIND 319

  Fly   265 YINTLHGFSNMVIRERKAELAILQENNNNNNNNAPDAYDDVGKKKRLAFLDLLIDASKEGTVLSN 329
            .::.|......::.|.:     ||.:....|...|            :.|..|:   ..|..:|:
plant   320 TLDDLIATCKRMVEEEE-----LQFHEEYMNERDP------------SILHFLL---ASGDDVSS 364

  Fly   330 EDIREEVDTFMFEGHDTTSAAISWTLFLLGCHPEYQERVVEELDSIFGDDKETPATMKNLMDMRY 394
            :.:|:::.|.:..||:|::|.::||.:||...|....::.||:||:.||...|...||.|   :|
plant   365 KQLRDDLMTMLIAGHETSAAVLTWTFYLLTTEPSVVAKLQEEVDSVIGDRFPTIQDMKKL---KY 426

  Fly   395 LECCIKDSLRLFPSVPMMARMVGEDVNIGGKIVPAGTQAIIMTYALHRNPRVFPKPEQFNPDNFL 459
            ....:.:||||:|..|::.|...::..:|...:..|....|..:.|||:|..:...|:|||:.:.
plant   427 TTRVMNESLRLYPQPPVLIRRSIDNDILGEYPIKRGEDIFISVWNLHRSPLHWDDAEKFNPERWP 491

  Fly   460 PENCAGRHP------FAYIPFSAGPRNCIGQKFAILEEKAVISTVLRKYKIEAVDRREDLTLLGE 518
            .:   |.:|      |:|:||..|||.|||..||..|....|:.::|::..:.......:.:...
plant   492 LD---GPNPNETNQNFSYLPFGGGPRKCIGDMFASFENVVAIAMLIRRFNFQIAPGAPPVKMTTG 553

  Fly   519 LILRPKDGLRVKITPR 534
            ..:...:||::.:|.|
plant   554 ATIHTTEGLKLTVTKR 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 115/466 (25%)
CYP97A3NP_564384.1 PLN02738 1..595 CDD:215393 117/471 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 1 0.900 - - OOG6_100014
Panther 1 1.100 - - O PTHR24291
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.