DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and CYP72C1

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:251 Identity:59/251 - (23%)
Similarity:99/251 - (39%) Gaps:57/251 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VFLLGSILIFL-VVYNK------RRSRLVKYIEK--IPGPAAMPFLGNAIEMN------------ 74
            |||:|.:::.| .|:..      |..||.||::|  ..|.:....:|:..|.|            
plant    10 VFLIGFLILILNWVWRAVNWVWLRPKRLEKYLKKQGFSGNSYRILMGDMRESNQMDQVAHSLPLP 74

  Fly    75 VDHD-------ELFNRVIGMQKLWGTRIGINRVWQGTAPRVLLFEPETVEPILNSQKFVNK---- 128
            :|.|       .|.:.|:...|...|       |.|..|.|::.:|||:..|::..:...|    
plant    75 LDADFLPRMMPFLHHTVLKHGKKCFT-------WYGPYPNVIVMDPETLREIMSKHELFPKPKIG 132

  Fly   129 SHDYDYLHPWLGEGLLTSTDRKWHSRRKILTPAFHFKILDDFIDVFNEQSAVLA---RKLAVEVG 190
            ||::.:|     .|||.....||...|.||.|||....|...:..||.....:.   .:||...|
plant   133 SHNHVFL-----SGLLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSSCKEMLEEWERLASAKG 192

  Fly   191 SEAFNLFPYVTLCTLDIVCETAMGR------RIYAQSNSESEY----VKAVYGIGS 236
            :...:.:.:....|.:::...:.|.      :|:.....:.:.    ::|||..||
plant   193 TMELDSWTHCHDLTRNMLARASFGDSYKDGIKIFEIQQEQIDLGLLAIRAVYIPGS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 47/214 (22%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.