DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and CYP71A18

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001184964.1 Gene:CYP71A18 / 837705 AraportID:AT1G11610 Length:504 Species:Arabidopsis thaliana


Alignment Length:484 Identity:111/484 - (22%)
Similarity:212/484 - (43%) Gaps:66/484 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ITVFLLGSILIFLVVYNKRRSRLVKYIEKIPGPAAMPFLGNAIEMNV-DHDELFNRVIGMQKLWG 92
            :.|.|..:.|:.|::..|...|..|.:...|.|..:|.:||..:::: .|..|.:..:       
plant     5 LMVSLCLTTLLTLLLLKKFLKRTAKKVNLPPSPWRIPVIGNLHQLSLHPHRSLHSLSL------- 62

  Fly    93 TRIG-INRVWQGTAPRVLLFEPETVEPILNSQ--KFVNKSHDYDYLHPWLGEG---LLTSTDRKW 151
             |.| :..:..|..|.:::...|....||.:.  ||.|:... ..:|..:..|   :.......|
plant    63 -RYGPLMLLHFGRVPILVVSSSEAAHEILKTHDLKFANRPKS-KAVHGLMNGGRDVVFGPYGEYW 125

  Fly   152 HSRRKI-----LTPAFHFKILDDFIDVFNEQSAVLARKL-AVEVGSEAFNLFPYVTLCTLDIVCE 210
            ...:.:     ||.    |::..|..|..|:...:..|| .....|.|.||.......|.|:...
plant   126 RQMKSVCILNLLTN----KMVASFEKVREEEVNAMMEKLEKASCSSSAENLSELFVTLTSDVTSR 186

  Fly   211 TAMGRRIYAQSNSESEYVKAVYGIGSIVQSRQAKIWLQSDFIFSLTAEYKLHQSYINTLHGFSNM 275
            .::|:: |.:..:.....|.|..|..::  |:..|   .|::.:|        ::|:.::||::.
plant   187 VSLGKK-YWEDETAGGLKKRVRQIMELL--REFPI---GDYVPAL--------AWIDRINGFNSK 237

  Fly   276 VIRERKAELAILQENNNNNNNNAPDAYDDVGKKKRLAFLDLLIDASKE---GTVLSNEDIREEVD 337
            ::...:|...::::        ....:.:.|:.| ..|:::|:...||   |..:...||:..:.
plant   238 IVEVSRAYSDLMEK--------VVQEHLEAGEHK-ADFVNILLSIEKEKNNGFKVQRNDIKFMIL 293

  Fly   338 TFMFEGHDTTSAAISWTLFLLGCHPEYQERVVEELDSIFGDD----KETPATMKNLMDMRYLECC 398
            .....|..|:|..:.|.:..|..:||..:::..|:.|.....    ||     |.:.:||||:..
plant   294 DMFIGGISTSSTLLEWIMTELIRNPECMKKLQNEIRSTIRPHGSYIKE-----KEVENMRYLKAV 353

  Fly   399 IKDSLRLFPSVPM-MARMVGEDVNIGGKIVPAGTQAIIMTYALHRNPRVF-PKPEQFNPDNFLPE 461
            ||:..|:.|.:|: :.|::.|||.:.|..:.|||:.:|..:::||:|.:: |..|:|.|:..| :
plant   354 IKEVFRVHPPLPLILPRLLTEDVKVKGYDIAAGTEVLINAWSIHRDPAIWGPDAEEFKPERHL-D 417

  Fly   462 NCAGRH--PFAYIPFSAGPRNCIGQKFAI 488
            :....|  ...||||.:|.|.|.|...|:
plant   418 STLDYHGQDLKYIPFGSGRRICPGINLAM 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 104/454 (23%)
CYP71A18NP_001184964.1 p450 26..496 CDD:299894 106/463 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.