DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and CYP96A4

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_200045.1 Gene:CYP96A4 / 835308 AraportID:AT5G52320 Length:502 Species:Arabidopsis thaliana


Alignment Length:566 Identity:127/566 - (22%)
Similarity:223/566 - (39%) Gaps:152/566 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IFLVVY------NKRRSRLV---KYIEKIPG-----PAAMPFLGNAIEMNVDHDELFNRVIGMQK 89
            ||..||      .|....:|   ..:..:||     |....|:..|:|              .:.
plant    15 IFFFVYQCFSLHKKTPKHMVMNWPVLGMLPGVLFQIPRIYDFVTEALE--------------AEN 65

  Fly    90 LWGTRIGINRVWQGTAPRVLLFEPETVEPILNSQKFVN--KSHDYDYLHPWLGEGLLTSTDRKWH 152
            :.|..||   .|......:|..:|..::.||:| .|||  |...::.:..:||:|:.......|.
plant    66 MTGCFIG---PWLSGTDILLTVDPVNIQYILSS-NFVNYPKGKKFNKIFEFLGDGIFNVDSGLWE 126

  Fly   153 SRRK-----------------------------ILTPAFHFKILDDFID-----VFNEQSAVLA- 182
            ..|.                             ||..|....||.|..|     :|:..|.::| 
plant   127 DMRNSSHAIFSHQDFQSFSVSTSVSKLSQGLVPILDNAVEKHILVDLQDLFQRFLFDTSSTLMAG 191

  Fly   183 ---RKLAVEVGSEAFNLFPYVTLCTLDIVCETAMGRRIYAQSNSESEYVKAVYGIGSIVQSRQAK 244
               :.|:||:        |.|                         |:..|:.|:...:..|.  
plant   192 YDPKSLSVEM--------PKV-------------------------EFADAMDGVADAMFYRH-- 221

  Fly   245 IWLQSDFIFSLTAEYKLHQSYINT---------LHGFSNM---VIRERKAELAILQENNNNNNNN 297
              |:..|::|:       ||:|..         |..|..|   :|..::.|:    :|:.     
plant   222 --LKPAFLWSI-------QSWIGVGIEKKMRRGLDVFDQMLGKIISAKREEI----KNHG----- 268

  Fly   298 APDAYDDVGKKKRLAFLDLLIDASKEGTVLSNED--IREEVDTFMFEGHDTTSAAISWTLFLLGC 360
               .:|..|:...:....:.||.:|...:..:.|  ||:.:...:....||||:|::|..:||..
plant   269 ---IHDSKGEAMDVLTYYMTIDTTKYKHLKPSNDKFIRDTILGLVIAARDTTSSALTWFFWLLSK 330

  Fly   361 HPEYQERVVEELDSIFGDDKETPATMKNLMDMRYLECCIKDSLRLFPSVPMMARMVGE-DVNIGG 424
            :||...::.:|::...  .|..||.:..|:   ||:..:.::|||:||||...:...: ||...|
plant   331 NPEAMTKIRQEINKKM--PKFDPADLDKLV---YLDGAVCETLRLYPSVPFNHKSPAKPDVLPSG 390

  Fly   425 KIVPAGTQAIIMTYALHRNPRVF-PKPEQFNPDNFLPENCAGRHPFAY--IPFSAGPRNCIGQKF 486
            ..|....:.:|..|:|.|...|: ...|.|.|:.::.::...|...:|  :.|:||||.|:|::.
plant   391 HKVDKNWRVVIPIYSLGRMKSVWGDDAEDFRPERWISDSGMLRQESSYKFLAFNAGPRTCLGKRL 455

  Fly   487 AILEEKAVISTVLRKYKIEAVDRREDLTLLGELILRPKDGLRVKIT 532
            ..|:.|.|...::|.|.|:.|:..:... :..::||.:.||:|.:|
plant   456 TFLQMKTVAVEIIRNYDIKVVEGHKPKP-VPSVLLRMQHGLKVSVT 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 120/534 (22%)
CYP96A4NP_200045.1 p450 1..501 CDD:416425 127/566 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1194
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.