DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and AT5G51900

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_200003.1 Gene:AT5G51900 / 835265 AraportID:AT5G51900 Length:242 Species:Arabidopsis thaliana


Alignment Length:287 Identity:55/287 - (19%)
Similarity:99/287 - (34%) Gaps:116/287 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 IRERKAELAILQENNNNN---NNNAPDAYDDVGKKKRLAFLDLLIDASKEGTV-------LSNED 331
            |..|:.|:...|.|||::   :::|                :||....|..|.       ::::.
plant    40 ISARREEVKRSQVNNNDHFIRDSHA----------------NLLTSHIKLDTTQYQLLDPINDKF 88

  Fly   332 IREEVDTFMFEGHDTTSAAISWTLFLLGCHPEYQERVVEELD-----SIFGDDKETPATMKNLMD 391
            :|:.|...:..|.|||::|::|..:.|..:|....::.:|:|     |..|.::           
plant    89 LRDNVFALLLAGRDTTASALTWFFWFLSENPLVVTKIRQEIDMNLPRSCSGQER----------- 142

  Fly   392 MRYLECCIKDSLRLFPSVPMMARMVGEDVNIGGKIVPAGTQAIIMTYALHRNPRVFPKPEQFNPD 456
                           ||...|                                      |..|.|
plant   143 ---------------PSCDPM--------------------------------------EYLNKD 154

  Fly   457 NFLPENCAGRHPFAY-----------IPFSAGPRNCIGQKFAILEEKAVISTVLRKYKIEAVDRR 510
            :   |:|.||.....           :......|.|.|::.|:::.|.|...:|:.|.|:..:.:
plant   155 D---ESCMGRRCIRIQAREMDFRDRRVSIQCRSRICHGKQRAMVQMKIVAVEILQNYDIKVANGQ 216

  Fly   511 E---DLTLLGELILRPKDGLRVKITPR 534
            :   |.:    |||:.|.|.:|||..|
plant   217 KFEPDTS----LILKMKHGFKVKINKR 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 52/282 (18%)
AT5G51900NP_200003.1 p450 <2..239 CDD:299894 54/285 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.