DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and CYP93D1

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_196307.1 Gene:CYP93D1 / 830580 AraportID:AT5G06900 Length:507 Species:Arabidopsis thaliana


Alignment Length:526 Identity:115/526 - (21%)
Similarity:222/526 - (42%) Gaps:99/526 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YSPITVFLLGSILIFLVVYNKRRSRLVKYIEKIPGPAAMPFLGNAIEMNVDHDELFNRVI--GMQ 88
            :|.|.:..||..::...:.|:.|.||    ...|.|.|:|.:|        |..|...:.  .:.
plant     7 FSVIILVCLGITVLIQAITNRLRDRL----PLPPSPTALPIIG--------HIHLLGPIAHQALH 59

  Fly    89 KLWGTRIG-INRVWQGTAPRVLLFEPETVEPILNSQK--FVNK--SHDYDYLHPWLGEGLLTSTD 148
            || ..|.| :..::.|:.|.:::...|....||.|.:  |:|:  ..:.|||.....:.......
plant    60 KL-SIRYGPLMYLFIGSIPNLIVSSAEMANEILKSNELNFLNRPTMQNVDYLTYGSADFFSAPYG 123

  Fly   149 RKWHSRRKI-LTPAFHFKILDDFIDVFNEQ-SAVLARKLAVEVGSEAFNLFPYVTLCTLDIVCET 211
            ..|...::| :...|..:.||.|:.|.:|: ..:|.|.|......|:.||...:...|.:|:.  
plant   124 LHWKFMKRICMVELFSSRALDSFVSVRSEELKKLLIRVLKKAEAEESVNLGEQLKELTSNIIT-- 186

  Fly   212 AMGRRIYAQSNSESEYVKAVYGIGSIVQSRQAKIWLQSDFIFSLTAEYKLHQSYINTLHGFSNMV 276
               |.::.:..|:|:..:                  :|:.:..:..|       :|.|.||.|  
plant   187 ---RMMFRKMQSDSDGGE------------------KSEEVIKMVVE-------LNELAGFFN-- 221

  Fly   277 IRE-----RKAELAILQENNNNNNNNAPDAYDDV---------GKKKRLA----FLDLLIDASKE 323
            :.|     ::.:|..|::    ...||.|.||.:         ..||...    .||:|:|..::
plant   222 VSETFWFLKRLDLQGLKK----RLKNARDKYDVIIERIMEEHESSKKNATGERNMLDVLLDIYED 282

  Fly   324 GTV---LSNEDIREEVDTFMFEGHDTTSAAISWTLFLLGCHPEYQERVVEELDSIFGDDKETPAT 385
            ...   |:.|:|:..:......|.||::..:.|.|..|..|||..::..:|::.:.|:.:....:
plant   283 KNAEMKLTRENIKAFIMNIYGGGTDTSAITVEWALAELINHPEIMKKAQQEIEQVVGNKRVVEES 347

  Fly   386 MKNLMDMRYLECCIKDSLRLFPSVPMMARMVGEDVNIGGKIVPAGTQAIIMTYALHRNPRVFPKP 450
              :|.::.|.:..:|:::||.|..|:..|...|:..:.|..:||.|:.|:..:|:.|:...:..|
plant   348 --DLCNLSYTQAVVKETMRLHPGGPIFVRESDEECAVAGFRIPAKTRVIVNVWAIGRDSNQWEDP 410

  Fly   451 EQFNPDNF-------LPENCAGRHPFAYIPFSAGPRNCIGQKFAILEEKAVISTVLRKYKIE--- 505
            .:|.|:.|       :.|.        .:.|.||.|:|.|:|........:::.:::.::::   
plant   411 LEFRPERFEGSEWKVMSEK--------MMSFGAGRRSCPGEKMVFRFVPIILAAIIQCFELKVKG 467

  Fly   506 AVDRRE 511
            :||..|
plant   468 SVDMDE 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 107/493 (22%)
CYP93D1NP_196307.1 p450 7..500 CDD:299894 115/526 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.