DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and CPD

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_196188.1 Gene:CPD / 830453 AraportID:AT5G05690 Length:472 Species:Arabidopsis thaliana


Alignment Length:510 Identity:110/510 - (21%)
Similarity:191/510 - (37%) Gaps:121/510 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VFLLGSILI-FLVVYNKRRSRLVKYIEKIPGPAAMPFLGNAIEM----NVDHDELF--NRV---- 84
            :.||.||.. ||::..:.|.|.:..   .||...:|.:|...::    ..::.|.|  .||    
plant     7 LLLLSSIAAGFLLLLRRTRYRRMGL---PPGSLGLPLIGETFQLIGAYKTENPEPFIDERVARYG 68

  Fly    85 -IGMQKLWGTRIGINRVWQGTAPRVLLFEPETVEPILNSQKFV--NKSHDYDYLHP-----WLGE 141
             :.|..|:|            .|.:...:|||       .:||  |:...::..:|     .||:
plant    69 SVFMTHLFG------------EPTIFSADPET-------NRFVLQNEGKLFECSYPASICNLLGK 114

  Fly   142 GLLTSTDRKWHSRRKILTPAF-HFKILDD--FIDV-----FNEQSAVLARKLAVEVGSEAFNLFP 198
            ..|.......|.|...||.:| :..|:.|  .:|:     ||..| ..:|.|.:|   ||..:  
plant   115 HSLLLMKGSLHKRMHSLTMSFANSSIIKDHLMLDIDRLVRFNLDS-WSSRVLLME---EAKKI-- 173

  Fly   199 YVTLCTLDIVCETAMGRRIYAQSNS-ESEYVKAVYGIGSIVQSRQAKIWLQSDFIFSLTAEYKLH 262
                 |.::..:..|.......|.| ..||:..:.|..|:...           :||.|.. |..
plant   174 -----TFELTVKQLMSFDPGEWSESLRKEYLLVIEGFFSLPLP-----------LFSTTYR-KAI 221

  Fly   263 QSYINTLHGFSNMVIRERKAELAILQENNNNNNNNAPDAYDDVGKKKRLAFLDLLIDASKEGTVL 327
            |:........:.:|::.|:.|                    :.|.:::...|..|: |:.:|  .
plant   222 QARRKVAEALTVVVMKRREEE--------------------EEGAERKKDMLAALL-AADDG--F 263

  Fly   328 SNEDIREEVDTFMFEGHDTTSAAISWTLFLLGCHPEYQERVVEELDSI-----------FGDDKE 381
            |:|:|.:.:...:..|::|||..::..:..|...|....::.||.:.|           :.|.|.
plant   264 SDEEIVDFLVALLVAGYETTSTIMTLAVKFLTETPLALAQLKEEHEKIRAMKSDSYSLEWSDYKS 328

  Fly   382 TPATMKNLMDMRYLECCIKDSLRLFPSVPMMARMVGEDVNIGGKIVPAGTQAIIMTYALHRNPRV 446
            .|.|          :|.:.::||:...:..:.|....||.|.|..:|.|.:......|:|.:|..
plant   329 MPFT----------QCVVNETLRVANIIGGVFRRAMTDVEIKGYKIPKGWKVFSSFRAVHLDPNH 383

  Fly   447 FPKPEQFNPDNFLPENCAGRHPFAYIPFSAGPRNCIGQKFAILEEKAVISTVLRK 501
            |.....|||..:...:........:.||..|||.|.|.:.|    :..:|..|.:
plant   384 FKDARTFNPWRWQSNSVTTGPSNVFTPFGGGPRLCPGYELA----RVALSVFLHR 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 102/481 (21%)
CPDNP_196188.1 p450 1..472 CDD:386267 110/510 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.