DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and CYP96A12

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_195661.1 Gene:CYP96A12 / 830105 AraportID:AT4G39510 Length:508 Species:Arabidopsis thaliana


Alignment Length:506 Identity:126/506 - (24%)
Similarity:220/506 - (43%) Gaps:76/506 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 HDELFNR--VIGMQKLWGTRIGINRV--------------------WQGTAPRVLLFEPETVEPI 119
            |.::|..  ||||  |.|..:.::|:                    |......:...:|..:..|
plant    28 HGQVFRNWPVIGM--LPGFLMVLHRIYNFGVEALEMSHLTFLFKGPWFAEMDMLFTVDPANIHYI 90

  Fly   120 LNSQKFVN--KSHDYDYLHPWLGEGLLTSTDRKWHSRR-------------KILTPAFHFKILDD 169
            |:| .|.|  |..|:..:....||.:.:|....|.::|             |:...|...|:.|.
plant    91 LSS-NFSNYTKGADFKEVFDVFGEMIFSSDSELWKNQRKAAQFMLNHQGFQKLSLSATRSKLYDG 154

  Fly   170 FIDVFNEQSAVLARKLAVEVGSEAFNLFPYVTLCTLDIVCETAMGRRIYAQSNSESEYVKAVYGI 234
            .:.:||:   ....:..|:: .:.|..|.:.|  |..||  |....:..:....|.||.||:..:
plant   155 LVPLFNQ---CCEEEKVVDL-QQVFQRFTFDT--TFFIV--TGFDPKSLSIEMPEVEYAKALDDL 211

  Fly   235 GSIVQSRQAK---IW-LQSDFIFSLTAEYKLHQSYINTLHGFSNMVIRERKAELAILQENNNNNN 295
            |..:..|..|   .| ||:.  |.|..|.::.::.. |....|...|..::.|:.....:::.| 
plant   212 GEGIFYRHIKPKFFWKLQNR--FGLGQEKRMTEADA-TFDRVSAKYILAKREEIRSQGIDHHAN- 272

  Fly   296 NNAPDAYDDVGKKKRLAFLDLLIDASKEGTVLSNED--IREEVDTFMFEGHDTTSAAISWTLFLL 358
                      |:.:.|....:.:|.:|...:..::|  :|:.:..|...|.||||:|:||..:||
plant   273 ----------GESEDLLTSHIKLDTTKYELLNPSDDKFLRDTILAFNLAGRDTTSSALSWFFWLL 327

  Fly   359 GCHPEYQERVVEE-LDSIFGDDKETPATMKNLMDMRYLECCIKDSLRLFPSVPMMARM-VGEDVN 421
            ..:|:...::.:| :|.....|...  ..:||..:.||...:.:|:||:|.|....:. :..||.
plant   328 SENPQVVTKIRKEIIDKNISKDGRN--GQENLDKLVYLHAALYESMRLYPPVAFQRKSPIKPDVL 390

  Fly   422 IGGKIVPAGTQAIIMTYALHRNPRVFPK-PEQFNPDNFLPENCAGRH--PFAYIPFSAGPRNCIG 483
            ..|..|.|.:..||..:||.|...|:.: ..:|.|:.::.|:...||  .|.::.|:||||.|.|
plant   391 PSGHKVEANSVIIIFLFALGRMRAVWGEDATEFKPERWVSESGGLRHAPSFKFLSFNAGPRTCPG 455

  Fly   484 QKFAILEEKAVISTVLRKYKIEAVDRREDLTLLGELILRPKDGLRVKITPR 534
            ::.|:...|.|:..:|:.|.|:.: :.:.:.....|:|..|.||||.||.|
plant   456 KQLAMTLMKTVVVEILQNYDIDVI-KGQKIEPEPGLMLHMKHGLRVTITKR 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 123/501 (25%)
CYP96A12NP_195661.1 CYP86A 66..498 CDD:410687 110/457 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1194
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.