DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and CYP83B1

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_194878.1 Gene:CYP83B1 / 829277 AraportID:AT4G31500 Length:499 Species:Arabidopsis thaliana


Alignment Length:483 Identity:115/483 - (23%)
Similarity:203/483 - (42%) Gaps:68/483 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 RSRLVKYIEKIPGPAAMPFLGNAIEM---NVDH-----DELFNRVIGMQKLWGTRIGINRVWQGT 104
            ||...|.:...|||..:|.:||..:|   |..|     .:|:..:..| |:.|.|:.:  :....
plant    20 RSTTKKSLRLPPGPKGLPIIGNLHQMEKFNPQHFLFRLSKLYGPIFTM-KIGGRRLAV--ISSAE 81

  Fly   105 APRVLLFEPE---TVEPILNSQKFVNKSHDYDYLHPWLGEGLLTSTDRKWHSRRKILTPAFHFKI 166
            ..:.||...:   |..|:|..|:.::      |....||.|..|:..|:  .|:..:...|....
plant    82 LAKELLKTQDLNFTARPLLKGQQTMS------YQGRELGFGQYTAYYRE--MRKMCMVNLFSPNR 138

  Fly   167 LDDFIDVFNEQSAVLARKL---AVEVGS-EAFNLFPYVTLCTLDIVCETAMGRRIYAQSNSESEY 227
            :..|..|..|:...:..|:   |.:.|: :...|....|.|   :||..|.|:|..........:
plant   139 VASFRPVREEECQRMMDKIYKAADQSGTVDLSELLLSFTNC---VVCRQAFGKRYNEYGTEMKRF 200

  Fly   228 VKAVYGIGSIVQSRQAKIWLQSDFIFSLTAEYKLHQSYINTLHGFSNMVIRERKAELAILQE-NN 291
            :..:|       ..||   |.....||....|   ..:::.|.|.|..:.:..|.....||| .:
plant   201 IDILY-------ETQA---LLGTLFFSDLFPY---FGFLDNLTGLSARLKKAFKELDTYLQELLD 252

  Fly   292 NNNNNNAPDAYDDVGKKKRLAFLDLLIDASKE---GTVLSNEDIREEVDTFMFEGHDTTSAAISW 353
            ...:.|.|       |::..:|:|||:...|:   ....::|:::..:...:..|.||.:|.:.|
plant   253 ETLDPNRP-------KQETESFIDLLMQIYKDQPFSIKFTHENVKAMILDIVVPGTDTAAAVVVW 310

  Fly   354 TLFLLGCHPEYQERVVEELDSIFGDDKETPATMKNLMDMRYLECCIKDSLRLFPSVP-MMARMVG 417
            .:..|..:||..::..:|:.|:.||  :...:.:::.::.||:..||:||||.|.:| ::.|...
plant   311 AMTYLIKYPEAMKKAQDEVRSVIGD--KGYVSEEDIPNLPYLKAVIKESLRLEPVIPILLHRETI 373

  Fly   418 EDVNIGGKIVPAGTQAIIMTYALHRNPRVFPKPEQFNPDNFLPENCAGRH--------PFAYIPF 474
            .|..|||..:||.|...:..:|:.|:...:..    ||:.|:||.....|        .|..:||
plant   374 ADAKIGGYDIPAKTIIQVNAWAVSRDTAAWGD----NPNEFIPERFMNEHKGVDFKGQDFELLPF 434

  Fly   475 SAGPRNCIGQKFAILEEKAVISTVLRKY 502
            .:|.|.|......|...:...:.:|.|:
plant   435 GSGRRMCPAMHLGIAMVEIPFANLLYKF 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 112/472 (24%)
CYP83B1NP_194878.1 PLN03234 1..499 CDD:178773 115/483 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.