DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and CYP71A27

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_193757.3 Gene:CYP71A27 / 827771 AraportID:AT4G20240 Length:451 Species:Arabidopsis thaliana


Alignment Length:517 Identity:116/517 - (22%)
Similarity:203/517 - (39%) Gaps:119/517 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ESILLSKVGQVISGYSPITVFLLGSILIFLVVYNKRRSRLVKYIEKI-----PGPAAMPFLGNAI 71
            |.||:|              ..|.::|.||.:     ..|:|.|...     |.|..:|.:||..
plant     2 EMILIS--------------LCLTTLLAFLFL-----KPLLKRITTTKPKLPPSPWRLPVIGNLH 47

  Fly    72 EMNVDHDELFNRVIGMQKLWGTRIG-INRVWQGTAPRVLLFEPETVEPILNSQ--KFVNKSHD-- 131
            ::..:.....:.:       ..|.| :..:..|..|.:::..|:....|:.:.  ||.|:...  
plant    48 QLGPNPHRYLHSL-------SLRYGPLMLLHFGRVPVLVVSCPDVTNDIMKTHDLKFANRPKSKA 105

  Fly   132 --------YDYLHPWLGEGLLTSTDRKWHSRRKI-LTPAFHFKILDDFIDVFNEQSAVLARKL-A 186
                    .|.:....||        .|.|.:.: :....:.|::..|.::..|:..|:..|| .
plant   106 INIFMEGGRDIIFGPYGE--------DWKSMKSLGVVHLLNNKMVRSFENLREEEIKVMTEKLEE 162

  Fly   187 VEVGSEAFNLFPYVTLCTLDIVCETAMGRRIYAQSN---------SESEYV-KAVYGIGSIVQSR 241
            ....|.:.||...:...|.||:|...:||:...:..         :.||:. |..:|        
plant   163 ASSSSSSVNLSKLLMTLTNDIICRITLGRKYNEEEGGIDIKNLVMTSSEFFGKFFFG-------- 219

  Fly   242 QAKIWLQSDFIFSLTAEYKLHQSYINTLHGFSNMVIRERKAELAILQENNNNNN---NNAPDAYD 303
                    |||.||        ::|:.:.|..:.           :::.||..:   ::....:.
plant   220 --------DFIPSL--------AWIDWISGIDDK-----------MKDINNKLDCFLDSMVQEHV 257

  Fly   304 DVGKKKRLAFLDLLIDASKEGT---VLSNEDIREEVDTFMFEGHDTTSAAISWTLFLLGCHPEYQ 365
            |...|:...|:|:|:...|:.|   .....|:...:....|.|..||::.:.||:..|..|||..
plant   258 DADHKEPSDFIDMLLLIQKDKTKRFKFDRSDLILILKDMFFSGTATTASQLEWTMTELMRHPECM 322

  Fly   366 ERVVEELDSIFGDDKETPATMKNLMDMRYLECCIKDSLRLFPSVPMMARMVGEDVNIGGKIVPAG 430
            :::.:|::|.  .......|.|.:..|.||.|.||:.|||.||.|::.|:..|||.:.|..:.||
plant   323 KKLQDEINSF--STHNLNVTEKEVEKMNYLHCVIKEGLRLHPSGPLLFRLPSEDVQLKGYDISAG 385

  Fly   431 TQAIIMTYALHRNPRVFPKPEQFNPDNFLPENCAGRHPFAYIPFSAGPRNCI----GQKFAI 488
            |..||..:||.|||.::    ..:.:.:.||    ||....:.|:....|..    |:.||:
plant   386 THVIINAWALQRNPAIW----GLDANEYRPE----RHFGTNLDFNVLIPNSFHLEQGEDFAL 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 105/465 (23%)
CYP71A27NP_193757.3 p450 33..439 CDD:299894 104/465 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.