DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and CYP71A23

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001325471.1 Gene:CYP71A23 / 823988 AraportID:AT3G48300 Length:485 Species:Arabidopsis thaliana


Alignment Length:529 Identity:122/529 - (23%)
Similarity:224/529 - (42%) Gaps:97/529 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VFLLGSILIFLVVYNKRRSRLVKYIEKIPGPAAMPFLGNAIEMNVDHDELFNRVIGMQKLWGTRI 95
            :||...||..:.:...::.:.|..|...|.|..:|.:||..::: .|..  ..:..:...:|..:
plant     5 LFLCLIILFIITILFFKKHKTVNKIINFPSPPRLPLIGNLHQLS-QHPH--RSLCYLSHRYGPLM 66

  Fly    96 GINRVWQGTAPRVLLFEPETVEPILNSQKFVNKSHDYDYL---HPWLGEGLLTST--------DR 149
            .::   .|:.|.::....|....:|       |:||..:.   ...:.|.||..:        ..
plant    67 LLH---FGSVPVIVASTAEAARDVL-------KTHDRVFASRPRSKIFEKLLYKSRNMASAPYGE 121

  Fly   150 KWHSRRKILTPAFHF---KILDDFIDVFNEQSAVLARKLAVEVGSEAFNLFPYVTLCTLDIVCET 211
            .|...:.:  ...|.   |::..|.||..|:..::...:. :..|:..||...::..|.|::|..
plant   122 YWRQMKSV--SVLHLLSNKMVRSFQDVRQEEITLMMETIR-KSSSKPVNLSKILSSLTNDVICRV 183

  Fly   212 AMGRRIYAQSNSESEYVK------AVYGIGSIVQSRQAKIWLQ-SDFIFSLTAEYKLHQSYINTL 269
            |:||: |.......|.:.      ..:.|||.|.      ||. :|::..|.|..:      .|.
plant   184 ALGRK-YGVGTDFKELIDRLMRQLGTFTIGSYVP------WLAWTDWVSGLEARLE------KTA 235

  Fly   270 HGFSNMVIRERKAELAILQENNNNNNNNAPDAYDDVGKKKRLAFLDLLIDASKE---GTVLSNED 331
            :.|..::.|       |:|::.:             |...:..|:|:|:.|.::   |..:....
plant   236 NDFDKLLER-------IVQDHED-------------GDGDKTDFVDVLLAAQRDKSFGFDIDRLS 280

  Fly   332 IREEV-DTFMFEGHDTTSAAISWTLFLLGCHPEYQERVVEEL-------DSIFGDDKETPATMKN 388
            |:..| |.|: .|.||:|..:.|.:..|..||...:::.||:       .|:..||         
plant   281 IKAIVLDAFV-GGTDTSSTLVEWEMTELLRHPTCLKKLQEEVRTICKGKSSVSEDD--------- 335

  Fly   389 LMDMRYLECCIKDSLRLFPSVPMMA-RMVGEDVNIGGKIVPAGTQAIIMTYALHRNPRVF-PKPE 451
            :..|.||:..:|::|||.|.||:|. ....:||.:....:|||||.|:..:|:.|....: |...
plant   336 IQGMEYLKAVVKEALRLHPPVPLMVPHQSTQDVRLRDNHIPAGTQVIVNLWAVGREAATWGPDAN 400

  Fly   452 QFNPDNFL--PENCAGRHPFAYIPFSAGPRNCIGQKFAILEEKAVISTVLRKYKIEAVDRREDLT 514
            :|.|:..|  |.:..|: .|..|||.||.|.|.|..||::..:.|::.::..:..:::|...|:.
plant   401 EFRPERHLESPSDFRGQ-DFELIPFGAGRRMCPGISFAVVLNEVVLANLVHGFDWQSIDDETDVA 464

  Fly   515 -LLGELILR 522
             .:|.:|.|
plant   465 ESIGSVIRR 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 116/501 (23%)
CYP71A23NP_001325471.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.