DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and CYP71A26

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_680106.1 Gene:CYP71A26 / 823985 AraportID:AT3G48270 Length:489 Species:Arabidopsis thaliana


Alignment Length:524 Identity:120/524 - (22%)
Similarity:221/524 - (42%) Gaps:91/524 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ITVFLLGSILIFLVVYNKRRSRLVKYIEKIPGPAAMPFLGNAIEMNVDHDELFNRVIGMQKLWGT 93
            |..|||.||:..:.:...|:.:..|....:|.|..:|.:||..::. .|..  ..:..:...:|.
plant     3 IMFFLLCSIIFVVTIIIFRKQKRGKKRNTLPSPPGLPLIGNLHQLG-RHPH--RSLCSLSHRYGP 64

  Fly    94 RIGINRVWQGTAPRVLLFEPETVEPILNSQKFVNKSHD-------------------YDYLHPWL 139
            .:.::   .|..|.:::...|....:|       |:||                   :|......
plant    65 LMLLH---FGRVPVLVVSSAELARDVL-------KTHDRVFASRPRSKIFEKLLYDKHDVASAPY 119

  Fly   140 GEGLLTSTDRKWHSRRKI-LTPAFHFKILDDFIDVFNEQSAVLARKLAVEVGSEAFNLFPYVTLC 203
            ||        .|...:.: :...|..|::..|.:|..|:.:::..|:...: |...||...:...
plant   120 GE--------YWRQMKSVCVLHLFSNKMVRSFREVREEEISLMMEKIRKSI-SLPVNLSKILVSL 175

  Fly   204 TLDIVCETAMGRRIYAQSNSESEYVK------AVYGIGSIVQSRQAKIWLQ-SDFIFSLTAEYKL 261
            |.|::|:.|:||: |.......|.::      ..:.:||.|.      ||. .|:|..|..:.  
plant   176 TNDVICKVALGRK-YGGETDFKELMERLNKLLGTFSVGSYVP------WLAWIDWIRGLDCQL-- 231

  Fly   262 HQSYINTLHGFSNMVIRERKAELAILQENNNNNNNNAPDAYDDVGKKKRLAFLDLLIDASKEGTV 326
             :...|.:..|...|::                     |..|  |.:....|:|:|:...::.||
plant   232 -EKTANDVDKFFERVVQ---------------------DHVD--GNRDMTDFVDVLLAIQRDKTV 272

  Fly   327 ---LSNEDIREEVDTFMFEGHDTTSAAISWTLFLLGCHPEYQERVVEELDSIFGDDKETPATMKN 388
               ::...|:..|......|.||:|..:.|.:..|..||:..:|:.||:.:|..|  ::..:.:.
plant   273 GFEINRVSIKAIVMNVFVGGTDTSSTLMEWAMTELLRHPKCLKRLQEEVRTICKD--KSSVSEEE 335

  Fly   389 LMDMRYLECCIKDSLRLFPSVPMMA-RMVGEDVNIGGKIVPAGTQAIIMTYALHRNPRVF-PKPE 451
            :.:|.||:..||::|||.|.:|:|. ....:||.:|...:|||||.:|..:|:.|....: |..|
plant   336 IQNMSYLKAVIKEALRLHPPLPLMVPHESTQDVRLGDHHIPAGTQVLINAWAIGREAATWGPDVE 400

  Fly   452 QFNPDNFLPENCAGR-HPFAYIPFSAGPRNCIGQKFAILEEKAVISTVLRKYKIE-AVDRREDLT 514
            :|.|:..|..:...| ..|..|||.:|.|.|....||::..:.|::.::.::... :|:..||.|
plant   401 EFRPERHLDSSVDYRGQAFELIPFGSGRRICPAISFAVVLNEVVLANLVHRFDWRLSVESTEDQT 465

  Fly   515 LLGE 518
            .:.|
plant   466 EVAE 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 112/494 (23%)
CYP71A26NP_680106.1 p450 21..481 CDD:299894 114/506 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.