DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and Cyp4x1

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001003947.1 Gene:Cyp4x1 / 81906 MGIID:1932403 Length:507 Species:Mus musculus


Alignment Length:516 Identity:162/516 - (31%)
Similarity:253/516 - (49%) Gaps:56/516 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VFLLGSILIFLVVYNKRRSRLVKYIEKIPGPAAMPFLGNAIEMNVDHDELFNRVIGMQKLWGTRI 95
            ||.|..:|:..:....||.||::.:...|||.|...||:...:..|:.|..:.::.....     
Mouse    19 VFCLALVLMQAMKLYLRRQRLLRDLSPFPGPPAHWLLGHQKFLQEDNMETLDEIVKKHPC----- 78

  Fly    96 GINRVWQGTAPRVL-LFEPETVEPILNSQKFVNKSHDYDYLH----PWLGEGLLTSTDRKWHSRR 155
             ....|.|...... :::|:..:..|:     .......|||    |.:|.|||.....:|...|
Mouse    79 -AFPCWVGPFQAFFYIYDPDYAKIFLS-----RTDPKMQYLHQLLTPCIGRGLLNLDGPRWFQHR 137

  Fly   156 KILTPAFHFKILDDFIDVFNEQSAVL---------ARKLAVEVGSEAFNLFPYVTLCTLDIVCET 211
            .:||||||..||...:|.......|:         .::..:||       |.::.|.||||:.:.
Mouse   138 CLLTPAFHQDILKPCVDTMAHSVKVMLDKWEKMWTTQETTIEV-------FEHINLMTLDIIMKC 195

  Fly   212 AMGRRIYAQSNSESE-YVKAVYGIGSIVQSRQAKIWLQSDFIFSLTAEYKLHQSYINTLHGFSNM 275
            |.|:....|.|...| ||||.:.:|.|:.||....|...|.||.|:.:....|.....:|.::..
Mouse   196 AFGQETNCQINGTYESYVKATFELGEIISSRLYNFWHHHDIIFKLSPKGHCFQELGKVIHQYTEK 260

  Fly   276 VIRERKAEL--AILQENNNNNNNNAPDAYDDVGKKKRLAFLDLLIDASKEG-TVLSNEDIREEVD 337
            :|::||..|  .:.|::...:.                .|||:::.|..|. ...|:.|:|.||:
Mouse   261 IIQDRKKILKNQVKQDDTQTSQ----------------IFLDIVLSAQAEDERAFSDADLRAEVN 309

  Fly   338 TFMFEGHDTTSAAISWTLFLLGCHPEYQERVVEELDSIFGDDKETPATMKNLMDMRYLECCIKDS 402
            |||:.|||.::|:|||.|:.|..:||:|:|...|:.||.||.  :..|.:.|.:|.|...|||::
Mouse   310 TFMWAGHDASAASISWLLYCLALNPEHQDRCRTEIRSILGDG--SSITWEQLDEMSYTTMCIKET 372

  Fly   403 LRLFPSVPMMARMVGEDVNI-GGKIVPAGTQAIIMTYALHRNPRVFPKPEQFNPDNFLPENCAGR 466
            |||.|.||.::|.:.:.:.: .|..:|||...::..:.||.||.|:..|:.|:|..|..||...|
Mouse   373 LRLIPPVPSISRELSKPLTLPDGHSLPAGMTVVLSIWGLHHNPAVWNDPKVFDPLRFTKENSDQR 437

  Fly   467 HPFAYIPFSAGPRNCIGQKFAILEEKAVISTVLRKYKIEAVDRREDLTLLGELILRPKDGL 527
            ||.|::|||:||||||||:||:||.|..|:.:|..::: |.|...........:||||.|:
Mouse   438 HPCAFLPFSSGPRNCIGQQFAMLELKVAIALILLHFQV-APDLTRPPAFSSHTVLRPKHGI 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 154/488 (32%)
Cyp4x1NP_001003947.1 p450 47..499 CDD:278495 154/488 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844974
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.