DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and cyp26b1

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001072655.1 Gene:cyp26b1 / 780112 XenbaseID:XB-GENE-991500 Length:511 Species:Xenopus tropicalis


Alignment Length:423 Identity:107/423 - (25%)
Similarity:183/423 - (43%) Gaps:72/423 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 LGEGLLTSTDRKW-HSRRKILTPAFHFKILDDFIDVFNEQSAVLARKLAVEVGSEAFNLFPYVTL 202
            :||..|.||:  | .|.|.:|.|.   .:.:...|:...:..|.::..:.| ..|::  .|.:.|
 Frog   107 MGEHHLVSTE--WPRSTRMLLGPN---SLANSIGDIHRHKRKVFSKIFSHE-ALESY--LPKIQL 163

  Fly   203 CTLDIVCETAMGRRIYAQSNSES--EYVKAVYGIGSIVQSRQAKIWLQSDFIFSLTAE-----YK 260
            ...|.:       |::: ||.||  .|.:|        |....::.::....|.|:.|     ::
 Frog   164 VIQDTL-------RVWS-SNPESINVYCEA--------QKLTFRMAIRVLLGFRLSDEELSQLFQ 212

  Fly   261 LHQSYINTLHGFSNMV----------IRERK-----AELAILQENNNNNNNNAPDAYDDVGKKKR 310
            :.|.::..:  ||..|          ||.|:     .|.||.::..|....:..||         
 Frog   213 VFQQFVENV--FSLPVDVPFSGYRRGIRAREMLLKSLEKAIQEKLQNTQGKDYADA--------- 266

  Fly   311 LAFLDLLIDASKE-GTVLSNEDIREEVDTFMFEGHDTTSAAISWTLFLLGCHPEYQERVVEEL-- 372
               ||:||::.|| |..|:.:::::.....:|..:.||::|.:..:..|..||...|::.|||  
 Frog   267 ---LDILIESGKEHGKELTMQELKDGTLELIFAAYATTASASTSLIMQLLKHPSVLEKLREELRG 328

  Fly   373 DSIF--GDDKETPATMKNLMDMRYLECCIKDSLRLFPSVPMMARMVGEDVNIGGKIVPAGTQAII 435
            :||.  |...|....::.:..:.||:|.||:.||||..|....|.|.:...:.|..:|.|...:.
 Frog   329 NSILHNGCVCEGALRVETISSLHYLDCVIKEILRLFSPVSGGYRTVLQTFELDGFQIPKGWSVLY 393

  Fly   436 MTYALHRNPRVFPKPEQFNPDNF---LPENCAGRHPFAYIPFSAGPRNCIGQKFAILEEKAVIST 497
            .....|....||...:.|:||.|   ..|:..||  |.|:||..|.|||:|:..|.|..|.:...
 Frog   394 SIRDTHDTAPVFKDVDVFDPDRFGQDRTEDKDGR--FHYLPFGGGVRNCLGKHLAKLFLKVLAIE 456

  Fly   498 VLRKYKIEAVDRREDLTLLGELILRPKDGLRVK 530
            :....:.|...|... .::...::.|.|.|:|:
 Frog   457 LASMSRFELATRTFP-KIMPVPVVHPADELKVR 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 107/423 (25%)
cyp26b1NP_001072655.1 p450 1..468 CDD:386267 102/400 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.