DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and cyp46a1.3

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001038763.1 Gene:cyp46a1.3 / 692332 ZFINID:ZDB-GENE-060519-40 Length:491 Species:Danio rerio


Alignment Length:485 Identity:129/485 - (26%)
Similarity:213/485 - (43%) Gaps:72/485 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FLLGSILIFLVVYNKRRSRLVKYIEKIPGPAAMPFLGNAIEMNVDHDELFNRVIGMQK------- 89
            :||.::.:..:.|.....::.:..:.||||....||       :.|....|||...::       
Zfish    12 YLLSAVFVVFLAYCLYIHQVHQKYDHIPGPPRDNFL-------LGHIPTINRVTKSERHMNDLLL 69

  Fly    90 LWGTRIGINRVWQGTAPRVLLFE---PETVEPILNSQKFVNKSHDYDYL-----HPWLGEGLLTS 146
            :|..:.|  .|::..:...::..   ||..:.|:.|.|::.....|..|     ..:||.||:|:
Zfish    70 IWAEKYG--PVYRLNSFHYVIINVHCPEATKTIMMSPKYLKDPFIYKRLFGLFGKRFLGYGLVTA 132

  Fly   147 TDRK-WHSRRKILTPAFHFKILDDFIDVFNEQSAVLARKLAVEVGSEAFNLFP-----YVTLCTL 205
            ||.. |:.:|:|:.|||....|...|..|||.|..|..||.    ..|.|..|     .|...||
Zfish   133 TDHDIWYRQRRIMDPAFSSSYLRGLISTFNEMSERLMDKLE----EMAINKTPAVMHDLVNCVTL 193

  Fly   206 DIVCETAMGRRIYAQSNSESEYVKAVYGIGSIVQSRQAKIW-LQSDFIFSLTAEYKLHQSYINTL 269
            ||:|:.|.|..:.....:::.:.:|      |.|..|..:. |:..|.......:|         
Zfish   194 DIICKVAFGVDLNLFKQTDNPFQQA------IEQCLQGMVLDLRDPFCKFFPKNWK--------- 243

  Fly   270 HGFSNMVIRERKAELAILQENNN---NNNNNAPDAYDDVGKKKRLAFLDLLIDASKEGTVLSNED 331
                  .|:|.|....:|::...   .|...|.:..:||...    .|..::..:||..|.:.:|
Zfish   244 ------AIQETKGATVLLRKTGEQWIQNRKTAVEIGEDVPND----ILTQILKTAKEEKVNNTKD 298

  Fly   332 IREEVD---TFMFEGHDTTSAAISWTLFLLGCHPEYQERVVEELDSIFGDDKETPATMKNLMDMR 393
            ..:.:|   ||...|.:||:..:|:.:..||.|||..:|...|:|.:.|..::  .:.::|....
Zfish   299 HEQMLDNFVTFFIAGQETTANQLSFAIMELGRHPEIYKRAKAEVDEVLGTKRD--ISYEDLGKFT 361

  Fly   394 YLECCIKDSLRLFPSVPMMARMVGEDVNIGGKIVPAGTQAIIMTYALHRNPRVFPKPEQFNPDNF 458
            ||...:|::|||:|:.|...|.:.||:.|.|..:|.|...|..:|...|..:.|..|.:|:|:.|
Zfish   362 YLSQVLKETLRLYPTAPGTNRWLHEDMVINGIKIPGGISVIFSSYVAQRLEKHFKDPLKFDPERF 426

  Fly   459 LPENCAGRHP-FAYIPFSAGPRNCIGQKFA 487
               |.....| :.|.|||.|||:|:||.|:
Zfish   427 ---NVNAPKPYYCYYPFSLGPRSCLGQVFS 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 125/458 (27%)
cyp46a1.3NP_001038763.1 p450 39..452 CDD:278495 124/455 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.