DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and Cyp4f17

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001178915.1 Gene:Cyp4f17 / 500801 RGDID:1561655 Length:524 Species:Rattus norvegicus


Alignment Length:548 Identity:184/548 - (33%)
Similarity:287/548 - (52%) Gaps:78/548 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GYSPITV------------FLLGSILIFLVVYNKRRSRLVKYIEKIPGPAAMPFLGNAIEMNVDH 77
            |..|:||            .||..||.::..:.....||    ...|.|.:..:....:.:..::
  Rat    10 GRGPVTVSPWQLLLVVGTSLLLARILAWISAFYDNYCRL----RCFPQPPSRHWFWGHLNLVKNN 70

  Fly    78 DELFNRVIGMQKL-------------WGTRIGINRVWQGTAPRVLLFEPETVEPILNSQKFV--N 127
            :|      |:|.|             |   |||      ..|.:.|..|:.:.|||.:...|  .
  Rat    71 EE------GLQLLAEMSHQFQDIHLCW---IGI------FYPILRLIHPKFIGPILQAPAAVAPK 120

  Fly   128 KSHDYDYLHPWLGEGLLTSTDRKWHSRRKILTPAFHFKILDDFIDVFNEQSAVLARK---LAVEV 189
            :...|.:|.||||:|||.|...||..:|::|||||||.||..::..||:...::..|   |..: 
  Rat   121 EMIFYGFLKPWLGDGLLVSAGEKWSRQRRLLTPAFHFDILKPYVKNFNKSVNIMHAKWQRLTAK- 184

  Fly   190 GSEAFNLFPYVTLCTLDIVCETAMGRRIYA-QSN---SESEYVKAVYGIGSIVQSRQAKIWLQSD 250
            ||...::|.:::|.|||     ::.:.::: .||   |.|||:.|:..:.|::..|..:.:|..|
  Rat   185 GSARLDMFEHISLMTLD-----SLQKCVFSFDSNCQESPSEYIAAIQELSSLIVKRHHQPFLYMD 244

  Fly   251 FIFSLTAEYKLHQSYINTLHGFSNMVIRERKAELAILQENNNNNNNNAPDAYDDVGKKKRLAFLD 315
            |::.|||:.:..:...:.:|.|::.|||||:..|         ::.:..:......|.|.|.|:|
  Rat   245 FLYYLTADGRRFRKACDLVHNFTDAVIRERRRTL---------SSQSVDEFLKSKTKSKTLDFID 300

  Fly   316 LLIDASKE-GTVLSNEDIREEVDTFMFEGHDTTSAAISWTLFLLGCHPEYQERVVEELDSIFGDD 379
            :|:.|..| |..||:||||.|.|||||.|||||::|:||.|:.|..|||:|||..:|:..:..|.
  Rat   301 VLLLAKDEHGKELSDEDIRAEADTFMFGGHDTTASALSWILYNLARHPEHQERCRQEVRELLRDR 365

  Fly   380 KETPATMKNLMDMRYLECCIKDSLRLFPSVPMMARMVGEDVNI-GGKIVPAGTQAIIMTYALHRN 443
            :.......:|..:.:|..|||:||||.|.|.:::|...:||.: .|:::|.|...||..:.:|.|
  Rat   366 EPEEIEWDDLTQLPFLTMCIKESLRLHPPVTVISRCCTQDVVLPDGRVIPKGNDCIISIFGVHHN 430

  Fly   444 PRVFPKPEQFNPDNFLPENCAGRHPFAYIPFSAGPRNCIGQKFAILEEKAVISTVLRKYKIEAVD 508
            |.|:|.||.::|..|..||...|.|.|:|||||||||||||.||:.|.|..::..|.::::...|
  Rat   431 PSVWPDPEVYDPFRFDSENPQKRSPLAFIPFSAGPRNCIGQTFAMNEMKVAVALTLLRFRLLPDD 495

  Fly   509 ---RREDLTLLGELILRPKDGLRVKITP 533
               ||:.     |||||.:.||.:::.|
  Rat   496 KEPRRKP-----ELILRAEGGLWLRVEP 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 173/498 (35%)
Cyp4f17NP_001178915.1 p450 52..514 CDD:278495 173/496 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348429
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.650

Return to query results.
Submit another query.