DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and Cyp313a3

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster


Alignment Length:511 Identity:143/511 - (27%)
Similarity:237/511 - (46%) Gaps:43/511 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LLGSILIFLVVYNKRRSRLVKYIEKIPGPAAMPFLGNAIEMNVDHDELFNRVIGMQKLWGTRIGI 97
            ||...:.|.:.:...|.||.....|||||..:|.||.|.|..:.:....:.......::|:..  
  Fly     7 LLAVGVCFWIYFLWSRRRLYMMHFKIPGPMGLPILGIAFEYLITYKRKMSIRTKYMDIYGSTC-- 69

  Fly    98 NRVWQGTAPRVLLFEPETVEPILNSQKFVNKSHDYDY-LHPWLGEGLLTSTDRKWHSRRKILTPA 161
             .||.|..|.|:..:|:..|.|..|.:.:|:|..:.. ::...|:|||:....||..|||.|.||
  Fly    70 -LVWVGPTPFVITRDPKIAEEIFLSPECLNRSSIFSKPVNSCTGDGLLSLEASKWVDRRKNLNPA 133

  Fly   162 FHFKILDDFIDVFNEQSAVLARKLAVEVGSEAFNLFPYVTLCTLDIVCETAMGRRIYAQSNSESE 226
            |...:|..|:.:||.::..|...|...||.....:...:...:..|..:|.:|..:...::.:::
  Fly   134 FKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEKKVRDDIVRWSFRIATQTTVGTDVKKDASFKND 198

  Fly   227 YVKAVYGIGSIVQSRQA--KIWLQSDFIFSLTAEYKLHQSYINTLHGFSNMVIRERKAELAILQE 289
                     |:::|.:.  || :..:.:...|     |....:||.||        :.:.|:.:.
  Fly   199 ---------SVLKSYETFMKI-IVMNVLLPFT-----HNKIFSTLGGF--------ETQKALAKS 240

  Fly   290 NNNNNNNNAPD----AYDDVGKKKRL-AFLDLLIDASKEGTVLSNEDIREEVDTFMFEGHDTTSA 349
            |.|.......|    ...:.|.:..: :.::..|:..:.|. :|.|:::.|..:|:....:||..
  Fly   241 NVNKMIGTIVDKKLMTKPESGSQPEITSVINKAIELHRNGE-MSREEVQSECCSFVVAAFETTGD 304

  Fly   350 AISWTLFLLGCHPEYQERVVEELDSIFGDDKETPATMKNLMDMRYLECCIKDSLRLFPSVPMMAR 414
            .:...|.||...||:|:.|.:||..:|....:...|..:|..|.:||..:.::|||.||||...|
  Fly   305 TVYHALILLAMFPEHQDTVYQELKELFPVAGDFEVTYDDLQRMVFLERVVNETLRLIPSVPFTPR 369

  Fly   415 MVGEDVNI-GGKIVPAGTQAIIMTYALHRNPRVF-PKPEQFNPDNFLPENCAGRHPFAYIPFSAG 477
            ....|..: .|.::|.|....|..:|.|||...: ..|..||||:|||:|...|||:||||||.|
  Fly   370 ETIRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTDPSSFNPDHFLPDNVRDRHPYAYIPFSKG 434

  Fly   478 PRNCIGQKFAILEEKAVISTVLRKYKIEAVDRREDLTLLGELILRPKDGLRVKITP 533
            .|||||.|:.::..|..:|.:||..|:....|.|||..:..:      |:.:..:|
  Fly   435 RRNCIGWKYGLMSSKLALSKILRNCKVSTSFRYEDLEFVDNI------GMELAQSP 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 134/481 (28%)
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 129/456 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.