DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and Cyp6a9

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster


Alignment Length:543 Identity:129/543 - (23%)
Similarity:224/543 - (41%) Gaps:116/543 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SILLSKVGQVISGYSPITVFLLGSILIFLVVYNKRRSRLVKYIEKIPGPAAMPFLGNAIEMNVDH 77
            |:||:           |.|.|:|.:|:       :..|.:.|.:.:..|...|.:          
  Fly     5 SVLLA-----------IVVVLVGYLLL-------KWRRALHYWQNLDIPCEEPHI---------- 41

  Fly    78 DELFNRVIGMQKLWGTRIGINRVW-------QGTA----------PRVLLFEPETVEPILNSQKF 125
              |...:.|:|    |....:.:|       :||.          |.:|:.:....:.||  .|.
  Fly    42 --LMGSLTGVQ----TSRSFSAIWMDYYNKFRGTGPFAGFYWFQRPGILVLDISLAKLIL--IKE 98

  Fly   126 VNKSHDYDYLH-----PWLGEGLLTSTDRKWHSRRKILTPAFH-----------FKILDDFIDVF 174
            .||..|..:.|     |..|: |.....:||.|.|..|:..|.           .|:..:||:||
  Fly    99 FNKFTDRGFYHNTEDDPLSGQ-LFLLDGQKWKSMRSKLSYTFTSGKMKYMFPTVVKVGHEFIEVF 162

  Fly   175 NEQSAVLARKLAVEVGSEAFNLFPYVTLCTLDIVCETAMGRRIYAQSNSESEYVKAVYGIGSIVQ 239
            .:   .:.:...|||..       .:...|.|::...|.|....:..:.|:|:  .|.|..:|.:
  Fly   163 GQ---AMEKSPIVEVRD-------ILARFTTDVIGTCAFGIECSSLKDPEAEF--RVMGRRAIFE 215

  Fly   240 SRQAKIWLQSDFIFSL-TAEYKLHQSYINTLHGFSNMVIRERKAELAILQENNNNNNNNAPDAYD 303
            .|...|.:.  ||.|. ....:||...  ||....:..:|..:..:|..::||...|:       
  Fly   216 QRHGPIGIA--FINSFQNLARRLHMKI--TLEEAEHFFLRIVRETVAFREKNNIRRND------- 269

  Fly   304 DVGKKKRLAFLDLLID---------ASKEGTVLSNEDIREEVDTFMFEGHDTTSAAISWTLFLLG 359
                     |:|.|||         .|.|...|:.|::..:...|...|.:|:|..:.:.|:.|.
  Fly   270 ---------FMDQLIDLKNSPLTKSESGESVNLTIEEMAAQAFVFFGAGFETSSTTMGFALYELA 325

  Fly   360 CHPEYQERVVEELDSIFGDDKETPATMKNLMDMRYLECCIKDSLRLFPSVPMMARMVGEDVNIGG 424
            .|.:.|:||.:|...:.| ......|.:::.||.||:..|.::|||:..:|::.|...||..:.|
  Fly   326 QHQDIQDRVRKECQEVIG-KYNGEITYESMKDMVYLDQVISETLRLYTVLPVLNRECLEDYEVPG 389

  Fly   425 K---IVPAGTQAIIMTYALHRNPRVFPKPEQFNPDNFLPENCAGRHPFAYIPFSAGPRNCIGQKF 486
            .   ::..|...:|...|:||:.:::..|..||||||.||....|....::||..|||||||.:|
  Fly   390 HPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRF 454

  Fly   487 AILEEKAVISTVLRKYKIEAVDR 509
            ..::.::.::.::.::|....::
  Fly   455 GQMQARSGLALLINRFKFSVCEQ 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 119/497 (24%)
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 119/495 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.