DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and Cyp9b2

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster


Alignment Length:561 Identity:137/561 - (24%)
Similarity:232/561 - (41%) Gaps:92/561 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SLMAESILLSKVGQVISGYSPITVFLLGSILIFLVVYNKRRSRLVKYIEKIPGPAAMPFLGN--- 69
            :|:...:.|..:|.:|..:|..|          ...:.:|:    .|.||     ..||:||   
  Fly     2 ALIEICLALVVIGYLIYKWSTAT----------FKTFEERK----LYFEK-----PYPFVGNMAA 47

  Fly    70 -AIEMNVDHDEL--FNRVIGMQKLWGTRIGINRVWQGTAPRVLLFEPETVEPIL--------NSQ 123
             |::.:....:|  |.......||.|       .:....|.:.|.:||.::.:.        |.|
  Fly    48 AALQKSSFQRQLTEFYERTRQHKLVG-------FFNMRTPMITLNDPELIKKVCVKDFDHFPNHQ 105

  Fly   124 KFVNKSHDYDYLHPWLGEGLLTSTDRKWHSRRKILTPAFHFKILDDFIDVFNEQSAVLARKL--- 185
            .|:..:   |.|   ..:.|....|::|...|..|||.|....:.:...:.||..|...:.|   
  Fly   106 PFITSN---DRL---FNDMLSVMRDQRWKHMRNTLTPVFTAAKMRNMFTLMNESFAECLQHLDSS 164

  Fly   186 -AVEVGSEAFNLFPYVTLC---TLDIVCETAMGRRIYAQSNSESEYVKAVYGIG-SIVQSRQAKI 245
             ....|.:.|.:...| :|   :.||:..||.|.::.:..|.::|:    |.|| |:|.||..:.
  Fly   165 SKTLPGRKGFEVDMKV-MCNKLSNDIIATTAFGLKVNSYDNPKNEF----YEIGQSLVFSRGLQF 224

  Fly   246 --WLQSDFIFSLTAEYKLHQSYINTLHGFSNMVIRERKAELAILQENNNNNNNNAPDAYDDVGKK 308
              ::.|..:..|.:..||.......:..|:.:|:.        ..:....:|...||        
  Fly   225 FKFMLSTLVPKLFSLLKLTIFDSAKVDYFARLVVE--------AMQYREKHNITRPD-------- 273

  Fly   309 KRLAFLDLLIDASKEG-TVLSNEDIREEVDTFMFEGHDTTSAAISWTLFLLGCHPEYQERVVEEL 372
                .:.||::|..|. ...::::|..:...|.|...:..|..|..|.:.|..:|:.|||:.||:
  Fly   274 ----MIQLLMEAKNESEDKWTDDEIVAQCFIFFFAAFENNSNLICTTTYELLYNPDVQERLYEEI 334

  Fly   373 DSIFGDDKETPATMKNLMDMRYLECCIKDSLRLFPSVPMMARMVGEDVNI----GGKI--VPAGT 431
            ..........|.|...:..|.|::..|.:|||.:.......|:..:|..:    |.|:  ...|.
  Fly   335 VETKKALNGAPLTYDAVQKMTYMDMVISESLRKWTLAAATDRLCSKDYTLTDDDGTKLFDFKVGD 399

  Fly   432 QAIIMTYALHRNPRVFPKPEQFNPDNFLPENCAGRHPFAYIPFSAGPRNCIGQKFAILEEKAVIS 496
            :..|....||.:.|.||:|.:|:||.|..|......|:.|:||..|||||||.::|:::.|.::.
  Fly   400 RINIPISGLHLDDRYFPEPRKFDPDRFSEERKGDMVPYTYLPFGVGPRNCIGNRYALMQVKGMLF 464

  Fly   497 TVLRKYKIEAVDRR-EDL--TLLGELILRPKDGLRVKITPR 534
            .:|..|||||..|. :||  :..| ....|:.|..:.:.||
  Fly   465 NLLLHYKIEASPRTIKDLWGSASG-FNFTPRSGFWMHLVPR 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 125/505 (25%)
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 120/483 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.