DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and Cyp9b1

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster


Alignment Length:493 Identity:119/493 - (24%)
Similarity:204/493 - (41%) Gaps:86/493 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 YIEKIPGPAAMPFLGNAIEMNVDH-------DELFNR-----VIGMQKLWGTRIGINRVWQGTAP 106
            |.||     ..|||||.....:..       .|.:||     ::|:..|             ..|
  Fly    34 YFEK-----PYPFLGNMAASALQKASFQKQISEFYNRTRHHKLVGLFNL-------------RTP 80

  Fly   107 RVLLFEPETVEPILNSQKFVNKSHDYDYL--HPWL--------GEGLLTSTDRKWHSRRKILTPA 161
            .:.:.:|:.::.|.        ..|:|:.  |..|        .:.|....|:.|.:.|.:|||.
  Fly    81 MIQINDPQLIKKIC--------VKDFDHFPNHQTLNIPNERLVNDMLNVMRDQHWRNMRSVLTPV 137

  Fly   162 FHFKILDDFIDVFNEQSAVLARKL----AVEVGSEAFNLFPYVTLC---TLDIVCETAMGRRIYA 219
            |....:.:...:.||..|.....|    .:..|..||.|...| ||   :.|::..||.|.::.:
  Fly   138 FTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGENAFELDMKV-LCNKLSNDVIATTAFGLKVNS 201

  Fly   220 QSNSESEYVKAVYGIGSIVQSRQAKIWLQSDFIFSLTAEYKLHQSYINTLHGFSNMVIRERKAEL 284
            ..:.|:|:    :.||..:...:...:|:  |:..|.|. |:...:..|:...:|:   |....|
  Fly   202 FDDPENEF----HTIGKTLAFSRGLPFLK--FMMCLLAP-KVFNFFKLTIFDSTNV---EYFVRL 256

  Fly   285 AI-LQENNNNNNNNAPDAYDDVGKKKRLAFLDLLIDASKEG-TVLSNEDIREEVDTFMFEGHDTT 347
            .: ..:....:|...||            .:.||::|.||. ...::::|..:...|.|...:..
  Fly   257 VVDAMQYREKHNITRPD------------MIQLLMEAKKESKDNWTDDEIVAQCFIFFFAAFENN 309

  Fly   348 SAAISWTLFLLGCHPEYQERVVEELDSIFGDDKETPATMKNLMDMRYLECCIKDSLRLFPSVPMM 412
            |..|..|.:.|..:.:.|||:.||:.......|..|.|.....:|.|::..|.:|||.:......
  Fly   310 SNLICTTAYELLRNLDIQERLYEEVKETQEALKGAPLTYDAAQEMTYMDMVISESLRKWTLSAAA 374

  Fly   413 ARMVGEDVNI----GGKI--VPAGTQAIIMTYALHRNPRVFPKPEQFNPDNFLPENCAGRHPFAY 471
            .|:..:|..:    |.|:  ..||....|....||.:.|.||:|::|:|:.|.........|:.|
  Fly   375 DRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLHWDERFFPQPQRFDPERFSERRKKDLIPYTY 439

  Fly   472 IPFSAGPRNCIGQKFAILEEKAVISTVLRKYKIEAVDR 509
            :||..|||:|||.::|:::.|.::..::..|||||..|
  Fly   440 LPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKIEASPR 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 116/488 (24%)
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 117/490 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.