DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and Cyp6t1

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster


Alignment Length:557 Identity:127/557 - (22%)
Similarity:221/557 - (39%) Gaps:87/557 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SKVITSLMAESILLSKVGQVISG--YSPITVFLLGSILIFLVVYNKRRSRLVKYIEKIPGPAAMP 65
            |.:..:|...|::|..|  |:.|  ...:|:..|..||.|   ::.||.       .:|...|.|
  Fly     6 SLIAAALAVGSLVLLPV--VLRGGCLLVVTIVWLWQILHF---WHWRRL-------GVPFVPAAP 58

  Fly    66 FLGNAIEMNVDHDELFNRVIG-------MQKLWGTRIGINRVWQGT----APRVLLFEPETVEPI 119
            |:||          ::|.:.|       .::|:.::....|.:.|.    ...:||.:|..::.|
  Fly    59 FVGN----------VWNLLRGACCFGDQFRELYESKEAAGRAFVGIDVLHNHALLLRDPALIKRI 113

  Fly   120 LNSQKFVNKSHDYDYLHPWL----GEGLLTSTDRKWHSRRKILTPAF-------HFKILDDFIDV 173
            : .:.|...|..::...|..    .:.|..|....|....||..|.|       .:.:|::....
  Fly   114 M-VEDFAQFSSRFETTDPTCDTMGSQNLFFSKYETWRETHKIFAPFFAAGKVRNMYGLLENIGQK 177

  Fly   174 FNEQSAVLARKLAVEVGSEAFNLFPYVTLC---TLDIVCETAMGRRIYAQSNSESEYVKAVYGIG 235
            ..|.   :.:||:   |.::..| ....||   |.||:...|.|...::..|.|:|:.:....:.
  Fly   178 LEEH---MEQKLS---GRDSMEL-EVKQLCALFTTDIIASLAFGIEAHSLQNPEAEFRRMCIEVN 235

  Fly   236 SIVQSRQAKIWLQSDFIFSLTAEYKLHQSYINTLHGFSNMVIRERKAELAILQENNNNNNNNAPD 300
            .....|...::..  |.|...:    |:  :.| |.:|....|..:..:..:......:..|..|
  Fly   236 DPRPKRLLHLFTM--FFFPRLS----HR--VGT-HLYSEEYERFMRKSMDYVLSQRAESGENRHD 291

  Fly   301 AYDDVGKKKRLAFLDLLIDASKEGTVLSNEDIREEVDTFMFEGHDTTSAAISWTLFLLGCHPEYQ 365
            ..|        .||.|......|..:...:....:....:..|.||:|:.|::.|:.|..:...|
  Fly   292 LID--------IFLQLKRTEPAESIIHRPDFFAAQAAFLLLAGFDTSSSTITFALYELAKNTTIQ 348

  Fly   366 ERVVEELDSIFGDDKETPATMKNLMDMRYLECCIKDSLRLFPSVPMMAR----MVGEDVN--IGG 424
            :|:..||.:.....::...:...:..:.||...:.:.|||:|....:.|    ..|.|::  .||
  Fly   349 DRLRTELRAALQSSQDRQLSCDTVTGLVYLRQVVDEVLRLYPPTAFLDRCCNSRTGYDLSPWNGG 413

  Fly   425 K--IVPAGTQAIIMTYALHRNPRVFPKPEQFNPDNFLPENCAGRHPFAYIPFSAGPRNCIGQKFA 487
            .  .:.|||...|....:||:.:.:|.||.|:|:.|..|.....||..|:||.||||.|||....
  Fly   414 SPFKLRAGTPVYISVLGIHRDAQYWPNPEVFDPERFSAEQRQQHHPMTYLPFGAGPRGCIGTLLG 478

  Fly   488 ILEEKAVISTVLRKYKIEAVDRREDLTLLGELILRPK 524
            .||.|..:..:|..:::|..:|     .|.|:...||
  Fly   479 QLEIKVGLLHILNHFRVEVCER-----TLPEMRFDPK 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 113/499 (23%)
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 103/450 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.