DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and cyp19a1a

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_571229.3 Gene:cyp19a1a / 30390 ZFINID:ZDB-GENE-990415-43 Length:517 Species:Danio rerio


Alignment Length:557 Identity:122/557 - (21%)
Similarity:211/557 - (37%) Gaps:151/557 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TVFLLGSILIFLVVYNKRRSRLVKYIEKIPGPAAMPFLGNAIEMNVDHDELFNRVI--GM---QK 89
            |:.||  :|..|:.....|    .:...||||:....||..:.        :.|.|  |:   ..
Zfish    45 TILLL--LLCLLLAIRHHR----PHKSHIPGPSFFFGLGPVVS--------YCRFIWSGIGTASN 95

  Fly    90 LWGTRIG-INRVWQGTAPRVLLFEPETVEPILNSQKFVNK-----------SHDYDYLHPWLGEG 142
            .:.::.| |.|||......::|.....|..:|....:.::           .|:         :|
Zfish    96 YYNSKYGDIVRVWINGEETLILSRSSAVYHVLRKSLYTSRFGSKLGLQCIGMHE---------QG 151

  Fly   143 LL-TSTDRKWHSRRKILTPAFHFKI--------------------LDDF---------IDVFNEQ 177
            :: .|....|...|     ||:.|.                    |||.         :|:.|  
Zfish   152 IIFNSNVALWKKVR-----AFYAKALTGPGLQRTMEICTTSTNSHLDDLSQLTDAQGQLDILN-- 209

  Fly   178 SAVLARKLAVEVGSEAFNLFPYVTLCTLDIVCETAMGRRIYAQSNSESEYVKAVYGIGSIVQSRQ 242
               |.|.:.|:|.:..|...|.                       :|.:.::.::......|:  
Zfish   210 ---LLRCIVVDVSNRLFLGVPL-----------------------NEHDLLQKIHKYFDTWQT-- 246

  Fly   243 AKIWLQSDFIFSLTAEYKLHQSYINTLHGFSNMVIRERKAELAILQENNNNNNNNAPDAYDDVGK 307
              :.::.|..|.|...:|.|:.....|......:|.::|.:||..:                  |
Zfish   247 --VLIKPDVYFRLDWLHKKHKRDAQELQDAITALIEQKKVQLAHAE------------------K 291

  Fly   308 KKRLAFLDLLIDASKEGTVLSNEDIREEVDTFMFEGHDTTSAAISWTLFLLGCHPEYQERVVEEL 372
            ...|.|...||.|...|. ||.|::|:.|...:....||.|.::.:.|.||..:|:.:.::::|:
Zfish   292 LDHLDFTAELIFAQSHGE-LSAENVRQCVLEMVIAAPDTLSISLFFMLLLLKQNPDVELKILQEM 355

  Fly   373 DSIFGDDKETPATMKNLMDMRYLECCIKDSLRLFPSVPMMARMVGEDVNIGGKIVPAGTQAIIMT 437
            ||:.....   ....:|..::.||..|.:|||..|.|....|...:|..|.|..|..||..|:..
Zfish   356 DSVLAGQS---LQHSHLSKLQILESFINESLRFHPVVDFTMRRALDDDVIEGYNVKKGTNIILNV 417

  Fly   438 YALHRNPRVFPKPEQFNPDNFLPENCAGRHPFAYIPFSAGPRNCIGQKFAILEEKAVISTVLRKY 502
            ..:||: ..|.||.||:.||| .:|...|.   :.||.:|||:|:|:..|::..|:::..:|.::
Zfish   418 GRMHRS-EFFSKPNQFSLDNF-HKNVPSRF---FQPFGSGPRSCVGKHIAMVMMKSILVALLSRF 477

  Fly   503 K--------IEAVDRREDL---------TLLGELILR 522
            .        :|.:.:..:|         :|..:||||
Zfish   478 SVCPMKACTVENIPQTNNLSQQPVEEPSSLSVQLILR 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 115/528 (22%)
cyp19a1aNP_571229.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589863
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.