DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and CYP4A22

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001010969.2 Gene:CYP4A22 / 284541 HGNCID:20575 Length:519 Species:Homo sapiens


Alignment Length:530 Identity:168/530 - (31%)
Similarity:279/530 - (52%) Gaps:59/530 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ISGYSPITVFLLGSILIFLVVYNK------RRSRLVKYIEKIPGPAAMPFLGNAIEMNVDHDELF 81
            :||...:|     |:||.|::..|      .|..|:|.:::.|.|.:....|:..|.  .||:..
Human    15 VSGILQVT-----SLLILLLLLIKAAQLYLHRQWLLKALQQFPCPPSHWLFGHIQEF--QHDQEL 72

  Fly    82 NRVIGMQK---------LWGTRIGINRVWQGTAPRVLLFEPETVEPILNSQKFVNKSH-DYDYLH 136
            .|:....|         :||.::           ||.|::|:.::.||....  .||| .|.:|.
Human    73 QRIQERVKTFPSACPYWIWGGKV-----------RVQLYDPDYMKVILGRSD--PKSHGSYKFLA 124

  Fly   137 PWLGEGLLTSTDRKWHSRRKILTPAFHFKILDDFIDVFNEQSAVLARKLAVEVGSEA-FNLFPYV 200
            |.:|.|||....:.|...|::||||||..||..::.:..:...|:..|....:|.:: ..:|.:|
Human   125 PRIGYGLLLLNGQTWFQHRRMLTPAFHNDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHV 189

  Fly   201 TLCTLDIVCETAMGRR--IYAQSNSESEYVKAVYGIGSIVQSRQAKIWLQSDFIFSLTAEYKLHQ 263
            :|.|||.:.::|...:  |....||:| |::|:..:.|:|.......:.::|.|:|||:..:...
Human   190 SLMTLDTIMKSAFSHQGSIQVDRNSQS-YIQAISDLNSLVFCCMRNAFHENDTIYSLTSAGRWTH 253

  Fly   264 SYINTLHGFSNMVIRERKAELAILQENNNNNNNNAPDAYDDVGKKKRLAFLDLLIDASKE-GTVL 327
            ......|..::.||:.|||:   ||:...         .:.:.:|:.|.|||:|:.|..| |::|
Human   254 RACQLAHQHTDQVIQLRKAQ---LQKEGE---------LEKIKRKRHLDFLDILLLAKMENGSIL 306

  Fly   328 SNEDIREEVDTFMFEGHDTTSAAISWTLFLLGCHPEYQERVVEELDSIFGDDKETPATMKNLMDM 392
            |::|:|.|||||||||||||::.|||.|:.|..||::|||..||:..:.||.  ...|..:|..|
Human   307 SDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHGLLGDG--ASITWNHLDQM 369

  Fly   393 RYLECCIKDSLRLFPSVPMMARMVGEDVNI-GGKIVPAGTQAIIMTYALHRNPRVFPKPEQFNPD 456
            .|...|||::|||:|.||.:.|.:...|.. .|:.:|.|...::..|.||.||:|:|..|.|:|.
Human   370 PYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGRSLPKGIMVLLSIYGLHHNPKVWPNLEVFDPS 434

  Fly   457 NFLPENCAGRHPFAYIPFSAGPRNCIGQKFAILEEKAVISTVLRKYKIEAVDRREDLTLLGELIL 521
            .|.|.  :.:|..|::|||.|.|||||::||:.:.|...:..|.::::.....|..:. :..|:|
Human   435 RFAPG--SAQHSHAFLPFSGGSRNCIGKQFAMNQLKVARALTLLRFELLPDPTRIPIP-MARLVL 496

  Fly   522 RPKDGLRVKI 531
            :.|:|:.:::
Human   497 KSKNGIHLRL 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 157/486 (32%)
CYP4A22NP_001010969.2 p450 52..505 CDD:278495 157/485 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154675
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.640

Return to query results.
Submit another query.