DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and Cyp3a18

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_665725.2 Gene:Cyp3a18 / 252931 RGDID:628709 Length:497 Species:Rattus norvegicus


Alignment Length:547 Identity:140/547 - (25%)
Similarity:242/547 - (44%) Gaps:83/547 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QVISGYSPITVFLLGSILIFLVVYNKRRSRLVKYIEKIPGPAAMPFLGNAIEMNVDHDELFNRVI 85
            ::|...|..|..||.:.|:...:|......|.|.: .||||..:|..|.          :||...
  Rat     2 EIIPNLSIETWVLLATSLMLFYIYGTYSHGLFKKL-GIPGPKPVPLFGT----------IFNYGD 55

  Fly    86 GM-----------QKLWGTRIGINRVWQGTAPRVLLFEPETVEPILNSQ---KFVNKSHDYDYLH 136
            ||           .|:||       .::|..|.:.:.:||.::.:|..:   .|.|:.    ...
  Rat    56 GMWKFDDDCYKKYGKIWG-------FYEGPQPFLAIMDPEIIKMVLVKECYSVFTNRR----CFG 109

  Fly   137 P--WLGEGLLTSTDRKWHSRRKILTPAFHFKILDDFIDVFNEQSAVLARKL-AVEVGSEAFNLFP 198
            |  ::.:.:..|.|.:|...|.||:|.|....|.:...:..:....|.:.| ..|...|..|:..
  Rat   110 PMGFMKKAITMSEDEEWKRLRTILSPTFTSGKLKEMFPLMRQYGDTLLKNLRREEAKGEPINMKD 174

  Fly   199 YVTLCTLDIVCETAMGRRIYAQSNSESEYVKAVYGIGSIVQSRQAKIWLQSDFIFS------LTA 257
            .....::|::..|:.|..:.:.:|.:..:|:....|        .|..:...|:.|      ||.
  Rat   175 IFGAYSMDVITGTSFGVNVDSLNNPQDPFVQKAKKI--------LKFQIFDPFLLSVVLFPFLTP 231

  Fly   258 EYKLHQSYI---NTLHGFSNMVIRERKAELAILQENNNNNNNNAPDAYDDVGKKKRLAFLDLLID 319
            .|::....|   .:::.|...|...:|..|                   |..:|.|:.||.|:::
  Rat   232 IYEMLNFSIFPRQSMNFFKKFVKTMKKNRL-------------------DSNQKSRVDFLQLMMN 277

  Fly   320 -----ASKEGTVLSNEDIREEVDTFMFEGHDTTSAAISWTLFLLGCHPEYQERVVEELDSIFGDD 379
                 ..:....||:.::..:...|:|.|:|.||.:||:.::.|...|..|:::..|:|...  .
  Rat   278 TQNSKGQESQKALSDLEMAAQAIIFIFGGYDATSTSISFIMYELATRPNVQKKLQNEIDRAL--P 340

  Fly   380 KETPATMKNLMDMRYLECCIKDSLRLFPSVPMMARMVGEDVNIGGKIVPAGTQAIIMTYALHRNP 444
            .:.|.|...||:|.||:..:.:||||:|....:.|:..:||.|.|..:|.||...|..|.|||||
  Rat   341 NKAPVTYDALMEMEYLDMVVNESLRLYPIATRLDRVSKKDVEINGVFIPKGTVVTIPIYPLHRNP 405

  Fly   445 RVFPKPEQFNPDNFLPENCAGRHPFAYIPFSAGPRNCIGQKFAILEEKAVISTVLRKYKIEAVDR 509
            ..:.:||:|||:.|..||.....|:.|:||..|||||||.:||::..|..:..||:.:.|:..::
  Rat   406 EYWLEPEEFNPERFSKENKGSIDPYVYLPFGNGPRNCIGMRFALISMKLAVIGVLQNFNIQPCEK 470

  Fly   510 RE-DLTLLGELILRPKDGLRVKITPRD 535
            .: .|.:..:.|.:|:..:.:|:..||
  Rat   471 TQIPLKISRQPIFQPEGPIILKLVSRD 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 127/503 (25%)
Cyp3a18NP_665725.2 CYP3A 67..492 CDD:410743 118/464 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.