DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and Klkb1

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_032481.2 Gene:Klkb1 / 16621 MGIID:102849 Length:638 Species:Mus musculus


Alignment Length:182 Identity:32/182 - (17%)
Similarity:52/182 - (28%) Gaps:83/182 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 PRVLLFEPETVEPILNSQK----FVNKS-----------------------HDYDYLHPWLGEGL 143
            ||.|||....|.|...:.|    |:.:|                       |.....|..:.:||
Mouse    55 PRCLLFSFLAVTPPKETNKRFGCFMKESITGTLPRIHRTGAISGHSLKQCGHQISACHRDIYKGL 119

  Fly   144 --------LTSTDRKWHSRRKILTPAFH--------------------------------FKILD 168
                    ::.|| .....:|:.|..||                                .|..|
Mouse   120 DMRGSNFNISKTD-NIEECQKLCTNNFHCQFFTYATSAFYRPEYRKKCLLKHSASGTPTSIKSAD 183

  Fly   169 DFIDVFNEQSAVLARKLAVEVGSEAFNLFPYVTLCTLDI---------VCET 211
            :.:..|:.:|..|:     |:|. ..::|.:.....|::         ||.|
Mouse   184 NLVSGFSLKSCALS-----EIGC-PMDIFQHSAFADLNVSQVITPDAFVCRT 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 32/182 (18%)
Klkb1NP_032481.2 APPLE 21..104 CDD:128519 10/48 (21%)
APPLE 111..194 CDD:128519 12/83 (14%)
APPLE 201..284 CDD:128519 5/30 (17%)
APPLE 292..375 CDD:128519
Tryp_SPc 390..621 CDD:214473
Tryp_SPc 391..621 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.797146 Normalized mean entropy S2580
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.