DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and CYP3A5

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_000768.1 Gene:CYP3A5 / 1577 HGNCID:2638 Length:502 Species:Homo sapiens


Alignment Length:541 Identity:143/541 - (26%)
Similarity:253/541 - (46%) Gaps:90/541 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TVFLLGSILIFLVVYNKRRSRLVKYIEKIPGPAAMPFLGNAIEMNVD----HDELFNRVIGMQKL 90
            |..||...|:.|.:|..|...|.|.: .||||..:|.|||.:.....    ..|.:.:   ..|:
Human    11 TWLLLAVSLVLLYLYGTRTHGLFKRL-GIPGPTPLPLLGNVLSYRQGLWKFDTECYKK---YGKM 71

  Fly    91 WGTRIGINRVWQGTAPRVLLFEPETVEPILNSQ---KFVNKSHDYDYLHP--WLGEGLLTSTDRK 150
            |||       ::|..|.:.:.:|:.:..:|..:   .|.|:..    |.|  ::...:..:.|.:
Human    72 WGT-------YEGQLPVLAITDPDVIRTVLVKECYSVFTNRRS----LGPVGFMKSAISLAEDEE 125

  Fly   151 WHSRRKILTPAFHFKILDDFIDVFNEQSAVLARKLAVEVG-------SEAFNLFPYVTLCTLDIV 208
            |...|.:|:|.|....|.:...:..:...||.|.|..|..       .:.|..:      ::|::
Human   126 WKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGAY------SMDVI 184

  Fly   209 CETAMGRRIYAQSNSESEYVKAVYGIGSIVQSRQAKIWLQSDFIFS----------LTAEYK-LH 262
            ..|:.|..|.:.:|.:..:|::            .|.:|:..|:..          ||..:: |:
Human   185 TGTSFGVNIDSLNNPQDPFVES------------TKKFLKFGFLDPLFLSIILFPFLTPVFEALN 237

  Fly   263 QSYI--NTLHGFSNMVIRERKAELAILQENNNNNNNNAPDAYDDVGKKKRLAFLDLLIDA--SKE 323
            .|..  :|::..|..|.|.:|:.|          |:.         :|.||.||.|:||:  |||
Human   238 VSLFPKDTINFLSKSVNRMKKSRL----------NDK---------QKHRLDFLQLMIDSQNSKE 283

  Fly   324 ---GTVLSNEDIREEVDTFMFEGHDTTSAAISWTLFLLGCHPEYQERVVEELDSIFGDDKETPAT 385
               ...||:.::..:...|:|.|::|||:.:|:||:.|..||:.|:::.:|:|::.  ..:.|.|
Human   284 TESHKALSDLELAAQSIIFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVL--PNKAPPT 346

  Fly   386 MKNLMDMRYLECCIKDSLRLFPSVPMMARMVGEDVNIGGKIVPAGTQAIIMTYALHRNPRVFPKP 450
            ...::.|.||:..:.::|||||....:.|...:||.|.|..:|.|:..:|.|||||.:|:.:.:|
Human   347 YDAVVQMEYLDMVVNETLRLFPVAIRLERTCKKDVEINGVFIPKGSMVVIPTYALHHDPKYWTEP 411

  Fly   451 EQFNPDNFLPENCAGRHPFAYIPFSAGPRNCIGQKFAILEEKAVISTVLRKYKIEAVDRRE-DLT 514
            |:|.|:.|..:. ....|:.|.||..|||||||.:||::..|..:..||:.:..:.....: .|.
Human   412 EEFRPERFSKKK-DSIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLK 475

  Fly   515 LLGELILRPKDGLRVKITPRD 535
            |..:.:|:|:..:.:|:..||
Human   476 LDTQGLLQPEKPIVLKVDSRD 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 130/506 (26%)
CYP3A5NP_000768.1 p450 39..492 CDD:365848 130/506 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.