DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and Cyp4a10

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_034141.3 Gene:Cyp4a10 / 13117 MGIID:88611 Length:509 Species:Mus musculus


Alignment Length:533 Identity:163/533 - (30%)
Similarity:276/533 - (51%) Gaps:74/533 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ISGYSPITVFLLGSILIFL--VVYNKRRSRLVKYIEKIPGPAAMPFLGNAIEMNVDHDELFNRVI 85
            :||:..: ..:||.:|:.:  |.:...|..|:|..::.|.|....|.|:         |.|.   
Mouse    15 LSGFLQV-ASVLGLLLLLVKAVQFYLHRQWLLKAFQQFPSPPFHWFFGH---------EKFK--- 66

  Fly    86 GMQKL------------------WGTRIGINRVWQGTAPRVLLFEPETVEPIL-NSQKFVNKSHD 131
            |.|:|                  ||::..:.           :::|:.::.|| .|....|.:  
Mouse    67 GDQELQEIVSCIENFPSAFPRWFWGSKAYLT-----------VYDPDYMKVILGRSDPKANGA-- 118

  Fly   132 YDYLHPWLGEGLLTSTDRKWHSRRKILTPAFHFKILDDFIDVFNEQSAVLARK---LAVEVGSEA 193
            |..|.||:|.|||....:.|...|::||||||:.||..::....:...::..|   ||.:  ..:
Mouse   119 YRLLAPWIGYGLLLLNGQPWFQHRRMLTPAFHYDILKPYVKNMADSIRLMLDKWERLADQ--DSS 181

  Fly   194 FNLFPYVTLCTLDIVCETAMGRR--IYAQSNSESEYVKAVYGIGSIVQSRQAKIWLQSDFIFSLT 256
            ..:|.:::|.|||.|.:.|...:  :....|..: |::|:..:.::..||...|:.|:|.|:.|:
Mouse   182 IEIFQHISLMTLDTVMKCAFSHKGSVQVDGNYRT-YLQAIGDLNNLFHSRVRNIFHQNDTIYKLS 245

  Fly   257 AEYKLHQSYINTLHGFSNMVIRERKAELAILQENNNNNNNNAPDAYDDVGKKKRLAFLDLLIDAS 321
            :..:|.:......|..::.||:.||.:   ||:...         .:.:.||:||.|||:|:.|.
Mouse   246 SNGRLAKQACQLAHDHTDGVIKLRKDQ---LQDEGE---------LEKIKKKRRLDFLDILLFAR 298

  Fly   322 KE-GTVLSNEDIREEVDTFMFEGHDTTSAAISWTLFLLGCHPEYQERVVEELDSIFGDDKETPAT 385
            .| |..:|::|:|.|||||||||||||::.:||..:.|..||::|:|..||:.|:.||.  :..|
Mouse   299 MENGDSMSDKDLRAEVDTFMFEGHDTTASGVSWIFYALATHPDHQQRCREEVQSLLGDG--SSIT 361

  Fly   386 MKNLMDMRYLECCIKDSLRLFPSVPMMARMVGEDVNI-GGKIVPAGTQAIIMTYALHRNPRVFPK 449
            ..:|..:.|...|||::|||:|.||.:.|.:...|.. .|:.:|.|.|..:..|.||.||:|:|.
Mouse   362 WDHLDQIPYTTMCIKEALRLYPPVPGIVRELSTSVTFPDGRSLPKGVQVTLSIYGLHHNPKVWPN 426

  Fly   450 PEQFNPDNFLPENCAGRHPFAYIPFSAGPRNCIGQKFAILEEKAVISTVLRKYKIEAVDRREDLT 514
            ||.|:|..|.|:  :.||..:::|||.|.|||||::||:.|.|.:::..|.::::.....|..:.
Mouse   427 PEVFDPSRFAPD--SPRHSHSFLPFSGGARNCIGKQFAMSELKVIVALTLLRFELLPDPTRVPMP 489

  Fly   515 LLGELILRPKDGL 527
             |..|:|:.|:|:
Mouse   490 -LARLVLKSKNGI 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 154/495 (31%)
Cyp4a10NP_034141.3 p450 52..503 CDD:278495 154/495 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844978
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.640

Return to query results.
Submit another query.